KEGG   Desulfovibrio salexigens: Desal_0981Help
Entry
Desal_0981        CDS       T00969                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
dsa  Desulfovibrio salexigens
Pathway
dsa00473  D-Alanine metabolism
dsa00550  Peptidoglycan biosynthesis
dsa01100  Metabolic pathways
dsa01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:dsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Desal_0981
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Desal_0981
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Desal_0981
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dsa01011]
    Desal_0981
Enzymes [BR:dsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Desal_0981
Peptidoglycan biosynthesis and degradation proteins [BR:dsa01011]
 Precursor biosynthesis
  Amino acid ligase
   Desal_0981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATPgrasp_ST CPSase_L_D2 ATP-grasp_4 GARS_A
Motif
Other DBs
NCBI-ProteinID: ACS79046
UniProt: C6C0B2
LinkDB All DBs
Position
complement(1101015..1101923)
Genome map
AA seq 302 aa AA seqDB search
MHVLLIAGGWSEEREVSLSGAKGIEQALLELGHDVEFVDPAKDFKNILLLAEHADFAFIN
LHGSPGEDGLIQAMLNQVNCPYQGAEPESSFLTLNKAATKTVFDHHGILTPKWELVCAAD
GCKGLQDLEPPVFIKPNSGGSSLGMTFARTAEELEKGIETVFSLGDSALVEEYTKGIEVT
CGILDGEPMPLILINPPDNAEFFDYHSKYALDGAEEICPAPIDPVLTEQIQQITAKAHKL
LGLTDYSRADFIISEGVPYLLEVNTLPGMTPTSLVPQAAKEAGYSFNELIAKLIELGQRK
RK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcatgttctcttgattgcgggcggctggtctgaggaaagggaagtatcccttagcggc
gcaaaaggcattgaacaggctcttctcgaacttggtcacgatgtggaattcgttgatcct
gcaaaagacttcaagaatatcctgcttttggctgaacatgctgatttcgcttttatcaac
ctccacggttcgccgggagaagacggcctgattcaggccatgctcaatcaggttaactgc
ccgtatcagggtgctgaacctgaaagttctttcctgaccctgaacaaagctgcaaccaaa
actgtctttgatcaccacggtatcctgactcccaaatgggagctggtctgtgccgctgac
ggatgcaaaggcttgcaggaccttgaacctccggttttcatcaaaccgaactccggtggt
tccagcctcggcatgacctttgcccgtacagcagaggaactggaaaaaggaatcgaaaca
gtattcagtctgggcgacagcgcccttgttgaggagtacaccaaaggtattgaggtgacc
tgcggtatccttgatggcgagcctatgccgctgatcctgatcaatcctccggataatgcc
gaattctttgactatcatagcaaatacgcccttgacggggcggaagagatatgccccgcc
cccatcgatccggttctgactgagcagattcagcagatcacggccaaagcccacaagctg
ctgggcctgaccgattacagcagggctgattttataatttcagaaggagtgccctacctg
ctggaagtgaacacacttcccggcatgactccgacaagtcttgtcccgcaggccgcaaaa
gaagcgggttattcattcaatgaactgatcgcaaagctcattgaactgggacagcgcaag
cggaagtaa

DBGET integrated database retrieval system