KEGG   Desulfovibrio salexigens: Desal_1628Help
Entry
Desal_1628        CDS       T00969                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
dsa  Desulfovibrio salexigens
Pathway
dsa00500  Starch and sucrose metabolism
dsa01100  Metabolic pathways
dsa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Desal_1628
Enzymes [BR:dsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Desal_1628
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase DUF3417 Glyco_transf_5
Motif
Other DBs
NCBI-ProteinID: ACS79690
UniProt: C6BSY6
LinkDB All DBs
Position
1779662..1782229
Genome map
AA seq 855 aa AA seqDB search
MQPLRVYSVVPRLPSQLKELWDLAYNYLFVWNSDIASIFSTIDQVLWRDCQQNPVKFLNS
LPQQQLEELAKDDFFVQRLKEAAKVQRSYLAREGCAYKFDGAKKGEPVVAYFSLEYGIGL
SLPIYSGGLGILAGDHLKSASDLNIPLIGVGLCYQHGYFRQYMTQDGWQQERYPSHDFEE
MSIKVAKDKNGKDVKFNFDMKGETLHVKVWQVEVGRVTLYLLDTNVPENSVSFRGITARL
YGGDLEMRLWQEILLGIGGVKALDALGLEPSVIHMNEGHSAFAGLERIRVFMTEHGLSFE
AAMEMVASSSIFTTHTPVPAGNDRFPAELMRPYFEPYAQTMGLAYKVFLSLGREDPRDDA
EQFCMTVLALKLSRFNNGVSKLHGHVSRNMWQKVWPQYPVEDVPIGAITNGVHMPTWVAT
DFSLLFDRYLGPNWREDPDCAKVWRQTDNIPDAELWRTHERLRERLVDFVRKRLRRQLMN
IGARRKEIELADEVLDPRALTIGFARRFATYKRAGLLLKDKERLLKIISDSRQPVQFIFA
GKAHPQDNEGKKLIQDLIQFCRREECRMSLVFLEDYDMKIANYMVQGCDIWLNTPRRPLE
ACGTSGMKAMANGVLQFSTPDGWWDEAYLPDNSLGWAIGRGEDYNDHEYQDFVESQTLYK
VLENDIIPEFYDRGHGSLPRSWIAKVKKALRILGPEFNANRMVEDYTEKAYQPAYSNYAT
MHKNEFQGAKELAAWRMEVMTKWSSLKVRNIRSETHTDVYVEEPIIITAEIFLNGLTTDN
VQVEIYAGPVGQDGKFARRNTVVMTPEEDMGGGWHVYQGEVMPHEAGRFGYTVRILPKHE
LLLDPHSLGLIHWAQ
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgcttcgcgtttacagcgtcgttccacgtctgcccagtcagctgaaagagctt
tgggacttggcatataactatctttttgtctggaacagcgacattgccagtatcttttct
accattgatcaggtcctctggcgggactgccagcagaatcctgtgaagtttttaaacagt
cttcctcagcagcagcttgaagaattggctaaagatgatttttttgtgcagcgactcaaa
gaagccgccaaggtacagagaagttatctggctcgtgaaggctgcgcttacaaatttgat
ggcgccaagaaaggtgagcccgttgttgcgtatttcagtttggaatatggtatcggcctt
agcctgcctatttattccggcggactcggtattctcgctggtgaccatcttaagtcagca
agtgacctgaatattccgttgattggtgtcggtctttgttaccagcacggttattttcgg
cagtacatgactcaggatggctggcagcaggagcgttatcccagtcatgactttgaggaa
atgtccattaaggttgccaaggataaaaatggaaaggacgtaaaattcaatttcgatatg
aaaggggaaacccttcatgttaaagtctggcaggtcgaagtcgggcgtgtaacactttat
ttgctcgataccaatgtacctgaaaactcggttagcttccggggaatcacagctcgtttg
tacggcggtgatcttgaaatgcgtctttggcaggaaatcctgcttggtatcggcggagtt
aaagcacttgatgcactcggacttgagccaagcgtcattcatatgaatgaaggtcattct
gcttttgcggggttggaacgaattcgtgttttcatgaccgagcatggcctttcttttgaa
gcggcgatggagatggtggcctcttccagtatttttaccacccatacccctgttccggct
ggtaacgaccgtttcccggctgaacttatgcgtccatactttgaaccgtatgcccagact
atggggcttgcctataaagtattcctttctctcggcagggaagatccccgcgatgatgcg
gagcaattctgcatgactgtactggctctcaagctttcccgttttaataatggtgtatca
aagcttcacgggcatgtttcgcggaacatgtggcagaaggtttggccgcagtatccggta
gaagatgttcccatcggagctatcaccaatggtgtacatatgcctacatgggtggcaaca
gatttctccttgctgtttgaccgttatcttggcccgaactggcgtgaggacccggattgc
gcaaaagtctggaggcagaccgataatatccccgatgcagaactctggcgcactcatgag
cgactcagggaacggctggtggatttcgttcgtaaacgtctgcgtcgccagctgatgaat
atcggtgcacggcgcaaggaaatcgaacttgcggacgaagtgcttgatcctcgcgctttg
actatcggttttgcacgtcgttttgctacttataaacgtgccggactgctgcttaaggat
aaggagcgtctgctcaagatcatttccgattcaaggcagcccgtgcagtttatttttgcc
ggtaaagctcatccgcaggataacgaaggtaagaaacttattcaggatcttatccaattc
tgccgccgtgaagagtgccgcatgagtcttgtcttccttgaagattatgacatgaaaatc
gccaactatatggttcagggttgcgatatctggctgaacactccgagacgtcctcttgag
gcctgcggaaccagcggcatgaaagccatggcaaacggtgtactccagttcagtactccg
gacggttggtgggatgaagcttatctgcctgataacagcctcggttgggctatcggtcgc
ggcgaagactacaacgatcatgaatatcaggattttgtggagagtcagaccctttacaaa
gttctggaaaatgacataattcccgagttctatgaccgtggtcatggcagccttccccgt
agctggattgccaaggtcaagaaggcgttacggattctgggacctgaattcaacgctaac
cgtatggtggaagattatactgaaaaggcatatcagcctgcatacagtaactacgccacc
atgcataagaatgaattccagggcgccaaggaactggctgcctggagaatggaagtgatg
actaagtggtccagcttgaaggttcgcaacattcgttcggaaactcatactgatgtatat
gttgaagaaccgatcattattaccgcagagatattccttaatggtttgactacggataat
gttcaggtggaaatctacgccggacctgttggacaggacggaaagtttgcccgccgcaac
actgtggttatgactcctgaggaagatatgggcggtggctggcatgtttatcagggtgaa
gttatgccccatgaggccggaaggttcggttataccgtacgtatcctgcccaagcatgaa
ctcctgcttgatcctcattctctcggacttatccattgggcacaataa

DBGET integrated database retrieval system