KEGG   Desulfovibrio salexigens: Desal_3152Help
Entry
Desal_3152        CDS       T00969                                 

Definition
(GenBank) MIP family channel protein
  KO
K02440  glycerol uptake facilitator protein
Organism
dsa  Desulfovibrio salexigens
Brite
KEGG Orthology (KO) [BR:dsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dsa02000]
    Desal_3152
Transporters [BR:dsa02000]
 Other Transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    Desal_3152
Ion channels [BR:dsa04040]
 Non-ion channels
  Aquaglyceroporins or glycerol-uptake facilitators
   Desal_3152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MIP
Motif
Other DBs
NCBI-ProteinID: ACS81203
UniProt: C6C1M8
LinkDB All DBs
Position
complement(3510679..3511386)
Genome map
AA seq 235 aa AA seqDB search
MSPFLGELIGTMILTLFGCGVVANCLLEKSKGQNGGWIVITMGWGMAVTFAIYVAGKYSG
AHINPAVTIGLAAGGYFPWASVPLYVAGQMIGAFIGAVICYFTYKCHWEPTQDAGLKLAV
FSTGPAIRCTGENFLCEFIGTFFLVFIILGIGANEFSQGLNPLVVGFFILAIGLSLGGPT
GYAINPARDLGPRIAHAILPIPGKGDSDWGYSWIPVVAPICGGVAGALVYKALVG
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgagtcctttcttaggcgaattaattggtacaatgattcttacccttttcggttgcggc
gtagttgccaactgccttcttgaaaaatccaaaggccagaacggtggctggattgtcatc
actatgggttggggtatggcagtaacatttgcaatctacgtagctggtaaatattccggc
gcacacatcaaccctgctgttaccatcggtcttgctgccggcggatatttcccctgggca
agtgttcccctctacgttgccggccagatgatcggcgcattcatcggtgcagtaatctgc
tacttcacctacaaatgccactgggaacccactcaggatgctggcctgaaactggctgta
ttctctaccggccctgctatccgctgcaccggtgaaaacttcctctgcgaatttatcggt
accttctttctggtattcatcatcctcggtatcggcgccaacgaattctctcagggcctg
aaccccctggttgtaggtttcttcattctcgcaatcggtctttcccttggtggtcccacc
ggttacgctatcaaccctgctcgtgacctcggtccccgtattgctcacgccatcctgccc
attcccggtaaaggcgacagcgactggggatactcctggattcctgttgtagcacctatc
tgcggtggtgttgcaggtgctctggtttacaaagctcttgtcggctaa

DBGET integrated database retrieval system