KEGG   Desulfovibrio salexigens: Desal_3153Help
Entry
Desal_3153        CDS       T00969                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
dsa  Desulfovibrio salexigens
Pathway
dsa00564  Glycerophospholipid metabolism
dsa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Desal_3153
Enzymes [BR:dsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Desal_3153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_3 HI0933_like Pyr_redox_2 NAD_binding_8 GIDA
Motif
Other DBs
NCBI-ProteinID: ACS81204
UniProt: C6C1M9
LinkDB All DBs
Position
complement(3512047..3513609)
Genome map
AA seq 520 aa AA seqDB search
MKRSDYIQQMEDSSKVWDFIIIGGGATGLGSGLDAAARGYSVLLLEQGDFAEATSSRSTK
MVHGGVRYLAQGNISLVMEALYERGILKQNAPHMCYNQKFIVPDYKWWGLPYYGIGLKCY
DMLARKYSFGPSQIFTKGKVMQEVPGVLAKGLKGGVTYHDGQFDDARLALTLARTMADMG
GSPMNHTKVTGLVKNSTGYVCGVQAEDKLSGKSYELKAKAVINATGIFTDDVMNMDNPEH
KKLIAPSQGIHIVIDREFLGGETGIMVPKTDDGRVIFFVPWHGKVVVGTTDTALDGVCME
PKPLEEEINFLVEHSARYLAKAPTRADVRSVFTGIRPLIAAGDSESTSALSRDHYLTVSP
NKLLTIAGGKWTTYRHMAEDCIDNAIQMGGLPFRPCVTKNVKLHGYTEEFDHNDHMHVYG
SEAAEIMALAEESPELDARMHERLPYSWLEVVWAARHEWAQTVGDALSRRTRALIIDAKA
ANEVAPKAAEIMAKELGKDEAWVKEQVEQFQELAKNYIVD
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgttcagattatattcagcagatggaagatagctcaaaagtctgggatttcatt
attataggtggtggtgctaccggtctcggttccggtcttgatgctgctgcacgtggttat
tccgttcttcttcttgagcagggcgattttgccgaagctacttccagccgtagtactaaa
atggttcacggtggtgttagatacctcgctcagggtaatatttccctggttatggaagcc
ctgtacgaacgcggaattctcaagcagaacgctccgcacatgtgctacaaccagaaattc
atcgttcccgactacaaatggtggggtcttccctactacggcatcggcctgaaatgctac
gatatgctggctagaaaatacagcttcggtccttcccagatctttactaaaggtaaagtt
atgcaggaagtccccggtgttctcgccaaaggtcttaagggcggcgtaacctaccatgac
ggccagtttgacgatgcccgtcttgctctgactcttgcccgtaccatggcagatatgggt
ggttctccaatgaaccacactaaggttaccggtctggttaagaactccaccggctacgtc
tgtggtgttcaggcagaagataagctgtccggtaagagctacgagctcaaagccaaagct
gttatcaacgctaccggtattttcaccgatgacgttatgaacatggataaccccgagcat
aagaaactgatcgcacccagccagggtattcatatcgttatcgatcgtgaattcctcggt
ggtgaaaccggtatcatggttcccaagaccgatgacggccgtgtaattttcttcgtgccc
tggcacggtaaggtagttgtcggtaccactgataccgctcttgacggtgtctgcatggag
cccaagccccttgaagaggagatcaacttcctcgttgagcactccgctcgttatcttgcc
aaggcacctacccgtgctgatgttcgcagtgttttcaccggtattcgtccccttatcgca
gcaggtgattctgaatccacctccgcactttcaagggatcattacctgactgtgtctccc
aacaaactgctgactattgccggtggtaaatggaccacttacagacacatggctgaagac
tgcattgataacgcaatccagatgggcggcctgcctttccgtccctgcgtgaccaagaac
gttaagctgcacggttacactgaagagtttgatcacaacgatcacatgcatgtttacggt
agcgaagctgctgaaatcatggctctggctgaagaatctcctgagcttgatgcgcgcatg
catgaaagactgccttactcttggcttgaagttgtctgggctgcccgtcacgaatgggct
cagactgtcggcgatgctttgtcccgcaggaccagagctctgatcattgacgcaaaagct
gctaatgaagttgctcctaaggctgctgaaattatggctaaagagcttggtaaagatgaa
gcttgggtcaaagaacaggttgaacagttccaggagctggctaagaactacattgtagac
taa

DBGET integrated database retrieval system