KEGG   Desulfovibrio salexigens: Desal_3305Help
Entry
Desal_3305        CDS       T00969                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
dsa  Desulfovibrio salexigens
Pathway
dsa00473  D-Alanine metabolism
dsa01100  Metabolic pathways
dsa01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:dsa00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Desal_3305
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Desal_3305
Enzymes [BR:dsa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Desal_3305
Peptidoglycan biosynthesis and degradation proteins [BR:dsa01011]
 Precursor biosynthesis
  Racemase
   Desal_3305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Arteri_nsp7a
Motif
Other DBs
NCBI-ProteinID: ACS81355
UniProt: C6BRX2
LinkDB All DBs
Position
3683163..3684311
Genome map
AA seq 382 aa AA seqDB search
MNNPKTFAPIWAEVDLSAISHNFSEVQRLVNKQSKIMAVVKADAYGHGLTKVADCLNKAG
ADYFAVARLDEAVALRNHGIEKPILILGYTPPEAATELLKHKVIQTVFSSEYAKDLNEKL
NQTNKTLKVHIKIDTGMGRLGLVDEFNDGAVLESISTINRLPNLETEGVYTHFAASDEAD
KTSALEQLKQFKNILAGIERRGISIPLKHAANSAAIIDLPESYFDMVRPGIMLYGLYPSN
GVHQQNAELRPAMQIKARIAQTKEVPAGFRISYGHTYTTPNATKLATIPLGYADGYRRQL
SSAGKVLVHGQHASIVGRVCMDQSVIDVGKIENVEAGDEVVIIGRQEQAEISAERMACEL
GTINYEIVSTLMARVPRIFKDS
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaataaccccaaaactttcgcccccatctgggcagaagtggacctgtccgcgatcagc
cataacttcagtgaggttcaacggctggtaaacaagcagtcaaagataatggctgttgta
aaagctgatgcatacggacacgggctcacaaaggtagcggactgtttaaacaaagccgga
gccgactattttgcagtagcgcgcttggatgaagctgtagcacttcgcaatcacggcatt
gaaaagccgattctgatcctcggctacactccccccgaggctgcaacagaactgctcaaa
cacaaggtcattcaaacagtattttcaagtgaatatgccaaagatttaaacgaaaaactc
aaccagacaaacaagacattaaaagttcacattaaaatcgacaccggaatgggccggtta
ggtcttgttgacgaattcaatgacggagcagtgctggaatccatcagcacaatcaatcgc
cttcccaatctggaaacagagggtgtttatactcatttcgcagcgagtgatgaagcggac
aaaaccagtgcgcttgaacaactgaaacagttcaaaaacattctcgctggcattgaacgc
agagggatcagcatccccctcaagcatgcagccaacagtgccgcaattattgatctcccg
gaatcatactttgatatggtccgccccggaataatgctttacggcctttatccctcaaac
ggagtccaccagcagaatgccgaactaaggccggccatgcagataaaagcccgtattgca
caaacaaaagaagtccctgccggattcaggatcagctacgggcacacctacaccaccccg
aatgcaactaaactggctacaattccgctcggatatgcggacggctatagaaggcaactc
tcgtcagcaggtaaagtactggtccacggacagcatgcatcgatagttggaagggtctgc
atggatcaaagcgtcattgatgtagggaaaatcgagaatgttgaggccggagatgaagtg
gtcatcatcggcagacaggaacaggctgaaatttcggcagaaaggatggcctgcgaacta
ggaacaatcaattatgagattgtttccacacttatggccagagttccgaggatttttaag
gactcgtaa

DBGET integrated database retrieval system