KEGG   Desulfovibrio salexigens: Desal_3551Help
Entry
Desal_3551        CDS       T00969                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
dsa  Desulfovibrio salexigens
Pathway
dsa00250  Alanine, aspartate and glutamate metabolism
dsa00410  beta-Alanine metabolism
dsa00430  Taurine and hypotaurine metabolism
dsa00650  Butanoate metabolism
dsa01100  Metabolic pathways
dsa01110  Biosynthesis of secondary metabolites
dsa01120  Microbial metabolism in diverse environments
dsa02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:dsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Desal_3551
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Desal_3551
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Desal_3551
   00430 Taurine and hypotaurine metabolism
    Desal_3551
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Desal_3551
Enzymes [BR:dsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Desal_3551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ACS81597
UniProt: C6BTB6
LinkDB All DBs
Position
3972565..3973962
Genome map
AA seq 465 aa AA seqDB search
MLHEKDKIRAELLDDIYASSDLSLTMPKYKFPEEEHLPRDVYQVVHDELMLDGNSRQNLA
TFCSTWVDPEIHQLMDECVDKNMIDKDEYPQTAELENRCVHMLADLWNSPDAANTLGCST
TGSSEAAMLGGMAMKWRWREKMKAQGKPVDKPNMICGPVQICWHKFAKYWDVELREIPME
KDRLIMSPEEVIKRCDENTIGVVPTLGVTFTCDYEPVKEVCEALDKLQEETGLDIPVHVD
GASGGFIAPFCDPDLEWDFRIKRVKSINTSGHKFGLSPLGVGWIIWRDREDLPDDLIFWV
NYLGGNMPSFALNFSRPGGQIVAQYYNFLRLGKEGYRKIHQACYDTAAYIADEIDKLGVF
DIVYNGRGGIPAVSWSLKEGSNPGFNCYDLSDKLRSRGWQVPAYSMPAHREDLVLMRILV
RHGVSRDLGSLLIEDMKRCLDYFKKNPVTNSLGAEYGGYSHSSAK
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgctgcacgaaaaggacaagataagggcagaactgctggatgatatttacgcctcatcg
gacctctccctgaccatgcccaaatacaaattccctgaagaagaacaccttcccagagat
gtgtatcaggtagttcatgatgaattgatgcttgatggtaactcccgccagaatctggct
accttctgttccacatgggtagaccctgaaatccaccagctcatggatgagtgcgtggac
aaaaacatgatcgacaaggatgaatatccccagacggctgagctggaaaatcgttgtgtg
cacatgctggccgacctctggaactcacctgatgcagcaaacacccttggctgctccact
acaggttcgtccgaggcagccatgctcggcggcatggctatgaaatggcgctggcgtgaa
aagatgaaagcccaaggcaaacctgtggacaaaccgaatatgatctgcggtccggtccag
atctgctggcataaattcgcaaaatactgggatgttgaactgcgcgaaatccccatggaa
aaggaccgtttgataatgagtcctgaagaagtgatcaaacgctgcgacgaaaacaccata
ggagtcgtgcctacccttggagtaacattcacctgtgattacgagccggtcaaagaagtc
tgcgaagctttggacaagcttcaggaagaaaccggacttgatatccctgtccacgtggac
ggtgctagcggcggttttatcgccccgttctgcgacccggaccttgagtgggatttcagg
atcaaacgggtgaaatccatcaatacttccggccataagttcggcctttccccactcgga
gtaggctggatcatctggcgcgaccgcgaagaccttcctgatgatcttattttctgggtc
aactatctgggcggcaatatgccttcattcgccctgaacttttccagacccggaggccag
attgtggcccagtattacaacttcctgcgtctgggcaaagaaggctaccgcaaaatacat
caggcctgttatgacactgccgcatacattgccgatgaaattgataagctgggagtattc
gacattgtttacaatggaagaggcggtattcctgctgtttcatggtccctgaaagaaggc
agcaacccgggattcaactgctacgacctatcagacaagctgcgctccagaggctggcag
gttccggcctattccatgcccgcccaccgcgaagacttggtgctgatgcgcattcttgtt
cgtcacggtgtcagccgcgacctcggctcgctgcttatcgaagacatgaaaagatgtctg
gattactttaaaaagaacccggtaaccaactccctcggagctgaatacggcggatattct
cacagttctgccaagtag

DBGET integrated database retrieval system