KEGG   Drosophila sechellia: 6608701
Entry
6608701           CDS       T01064                                 

Definition
(RefSeq) bcl-2-related ovarian killer protein homolog B isoform X3
  KO
K20017  Bcl-2 family protein
Organism
dse  Drosophila sechellia
Pathway
dse04214  Apoptosis - fly
dse04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dse00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    6608701
   04215 Apoptosis - multiple species
    6608701
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 6608701
NCBI-ProteinID: XP_002033425
FlyBase: FBgn0176181
UniProt: B4HNS3
LinkDB
Position
2R
AA seq 299 aa
MPGTSYPTNNDNFSNGFPMATTQSERLLQAQNRRKFSFPATLHSASLLEVGGGPKETTRR
RLSNVSDAVTRKLSYTIGWKAAQIPAQDIISQGRCLCGHYIKRRLRRSGLFNKKLGLQRI
RSILGSTSMGIVRDVFPAVQVLGDELERMHPRIYNGVARQICRNPAGEFHTPDAVSLLLG
AVGRELFRVEITWSKVISLFAIAGGLSVDCVRQGHPEYLPKLMESVSEVIEDELVPWINE
NGGWSGINTHVLPTSNSLNPLEWTTLVIGVVFGLILVFMILRFIFNLIVPKIYQRFTNS
NT seq 900 nt   +upstreamnt  +downstreamnt
atgcccggcacctcgtatcccacgaataacgataatttcagcaacggatttccgatggcc
accacacaaagtgagcgcctcttgcaggcccagaatcgaagaaagttcagttttccagcc
acactgcattccgcatcccttctggaggtgggtggtggtcccaaggagaccacgaggcgg
aggttgagcaatgtcagcgatgccgtcaccaggaaactctcctacacgattggctggaag
gcggcacagattccagcgcaggatatcatttctcagggtcgttgcctgtgcggtcattat
atcaagagacgtcttagaagatccggtttgttcaacaaaaagctgggactgcagcgcata
cgtagcatactgggctccacctccatgggcattgtgcgcgatgtgtttcccgcggtccaa
gtgctgggcgatgaactggagcgcatgcatccccggatatacaacggagtagctcgtcag
atttgccgtaatccggctggtgagttccatactccggatgctgtgagcttgcttttggga
gccgttggtcgcgagctcttccgtgtggagattacgtggagcaaggtgatctctctgttc
gccatcgccggtgggctgtccgttgattgtgtgcgccaaggacatccggaatacttgccc
aagttgatggagagcgtttccgaggtgatcgaagatgagctggtgccgtggattaacgag
aatggtggttggagtggcatcaacacacacgttttacccaccagcaacagcctgaatcct
ttagagtggaccactttggtcataggcgtggtttttggcctaattttagtttttatgatt
ctgcgatttatatttaacttgatagtaccaaaaatataccaacgatttacgaattcctaa

DBGET integrated database retrieval system