KEGG   Drosophila sechellia: 6614887
Entry
6614887           CDS       T01064                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member wengen
  KO
K16679  wengen
Organism
dse  Drosophila sechellia
Pathway
dse04013  MAPK signaling pathway - fly
dse04214  Apoptosis - fly
dse04215  Apoptosis - multiple species
dse04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dse00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    6614887
   04391 Hippo signaling pathway - fly
    6614887
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    6614887
   04215 Apoptosis - multiple species
    6614887
SSDB
Motif
Pfam: TNFR_c6 Comm PhoR
Other DBs
NCBI-GeneID: 6614887
NCBI-ProteinID: XP_002039304
FlyBase: FBgn0177667
UniProt: B4I6U8
LinkDB
Position
X
AA seq 343 aa
MMPPRLPGGHGGAMRSRSSSSGHHLNTTFHKGRRRRQQHHIGGSHISISHGSYLALLLLS
TTCSLMATSASSSSSAADTDIAPPDPPPVSQVSIASSSPCAPQHWWDSQRDRCTPCTRCQ
GEMIPLRPCQLHTDTICGSIYDLKIDWVVLAKTEPNWKERRKSSEYEHFEPNAPLQHLTH
EQLQQLHEEAAAAWVLDWQTGVLYVAVLTCLVFFSVAACILIHHMRQWRRMERRLDQDVE
ELSTKLMAKLAEVQSLDGGTFFIGNADALRGLPASAATTHPATTQSGIFQPQHVLLPEKR
GKHQERRILKTLQPGNVYIEESNAGLGGMGVGLGVRGCSGLKG
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgatgccgccaagacttccaggcggccatggaggagccatgcgtagtcggagcagcagc
agtggccaccacttaaacacaacgtttcacaaaggccgacggaggcgacagcagcaccac
atcggtggcagccacatcagcatcagccacggcagctacctggccctgctactgctgtcc
accacctgctccctgatggccaccagcgcctcctcgtcatcctccgctgcagacacagac
attgcgccaccagatccgccgccggtcagccaggtgtccatcgcctccagctcaccctgc
gccccacagcattggtgggactcgcagcgggatcgctgcacaccgtgcacccgctgccag
ggcgagatgataccgctgcggccctgccagctacacacggacaccatctgcggctccata
tacgacctcaagatcgactgggttgtcctggccaagaccgaacccaattggaaggagcgc
cgaaagtcctccgagtatgagcacttcgagcccaatgccccactgcagcacctgacccac
gagcaactgcagcagctgcacgaggaggcggccgccgcctgggtcctcgactggcagact
ggagtcctctacgtggccgtgctcacctgcctggtcttcttctcggtggccgcctgcatc
ctcatccaccacatgcgccagtggcgtcgcatggagcgtcgcctagaccaggatgtggag
gagctgtcgaccaagctgatggccaagctggcggaggtgcagagcctggacggaggcacc
ttcttcatcggcaacgcggacgccttgcgaggcctgcccgcctccgcagcgacgacgcat
ccagcaacgacgcagtcggggatcttccagccacaacacgtgctgctgcctgagaaacgc
ggcaagcaccaggagcgacggatcctgaagaccctgcagcccggcaatgtctacatcgag
gagagcaacgctggactgggcggcatgggcgtgggcctgggcgtccgcggctgttccggc
ctgaagggctga

DBGET integrated database retrieval system