KEGG   Drosophila sechellia: 6615736
Entry
6615736           CDS       T01064                                 

Definition
(RefSeq) caspase-1
  KO
K20008  death caspase-1 [EC:3.4.22.-]
Organism
dse  Drosophila sechellia
Pathway
dse04214  Apoptosis - fly
dse04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dse00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    6615736
   04215 Apoptosis - multiple species
    6615736
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dse01002]
    6615736
Enzymes [BR:dse01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     6615736
Peptidases and inhibitors [BR:dse01002]
 Cysteine peptidases
  Family C14: caspase family
   6615736
SSDB
Motif
Pfam: Peptidase_C14 DUF4347
Other DBs
NCBI-GeneID: 6615736
NCBI-ProteinID: XP_002040107
FlyBase: FBgn0170941
UniProt: B4I8P7
LinkDB
Position
2R
AA seq 323 aa
MTDECVTRNYGVGILSPNGSENRGSFLMADNTDAKGCTPQSLVVGGAAAESPLPANKFVA
RMPVERYASEYNMSHKHRGVALIFNHEFFDIPSLKSRTGTNVDAQELKKAFENLGFAVSV
HKDCKLRDILKHVEKAAELDHTDNDCLAVAILSHGEHGYLYAKDTQYKLDNIWHYFTATF
CPSLAGKPKLFFIQACQGDRLDGGITLEKGVTETDGESSTSYKIPIHADFLFSYSTIPGY
FSWRNINNGSWYMQSLIRELNANGKKYDMLTLLTFVNQRVALDFESNVPATPMMDRQKQI
PCLTSMLTRILRFGDKPNGNKAG
NT seq 972 nt   +upstreamnt  +downstreamnt
atgaccgacgagtgcgtaaccagaaactacggagttggcattctcagcccgaacggatcg
gaaaatcggggcagctttcttatggctgataataccgatgccaagggctgtacgccgcag
tctcttgttgttggtggtgcagctgcagagagccccttgccggccaacaagtttgtggct
cgaatgcccgtggagcgctatgccagcgaatacaacatgagtcacaagcaccgcggagta
gcgctgatcttcaaccacgaattcttcgacataccctcgctgaagagccgcaccggaacg
aatgtcgatgcccaggagctgaagaaggcctttgaaaacctgggattcgcggtgtccgta
cacaaggactgcaagttgagggacatcctgaagcacgtagagaaggccgccgagctggat
cacacggacaacgactgccttgcggtggccatactctcgcacggggagcacggctaccta
tacgccaaggatacgcagtacaagctggacaacatctggcactacttcactgccaccttc
tgcccctcgctggcgggcaagccgaagctgttcttcatccaagcctgccagggcgaccgt
ttggacggagggatcaccctggagaagggcgttaccgagacggacggggagtcctcgact
agctacaagataccaatacacgccgactttctcttctcctactcgaccattccgggctac
ttctcctggcgcaacatcaacaacggctcctggtacatgcaatcgctgatccgcgagctg
aacgccaatggcaaaaagtacgacatgctcaccctgctcacattcgttaaccagcgcgta
gccctagactttgagtcgaacgtgcccgccacaccgatgatggatcgccagaagcagata
ccgtgccttacctccatgctgacgcgcatactgcgcttcggcgacaagccgaacgggaat
aaggctggctag

DBGET integrated database retrieval system