KEGG   Drosophila sechellia: 6618302
Entry
6618302           CDS       T01064                                 

Definition
(RefSeq) cell death protein Grim
  KO
K20018  cell death protein Grim
Organism
dse  Drosophila sechellia
Pathway
dse04214  Apoptosis - fly
dse04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dse00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    6618302
   04215 Apoptosis - multiple species
    6618302
SSDB
Motif
Pfam: RCR TFIIA
Other DBs
NCBI-GeneID: 6618302
NCBI-ProteinID: XP_032575341
FlyBase: FBgn0169866
LinkDB
Position
3L
AA seq 136 aa
MAIAYFIPDQAQLLARSYQQNGQQTAASARTTATPAAPPQQQQQSQQQQQQQHHQQQRPQ
FRANISVPLGSQQGSMTMSEFGCWDLLAQIFCYALRIYSYSSSQRQPTVIQISFEISSGG
QNNDEDDVTDATSKEN
NT seq 411 nt   +upstreamnt  +downstreamnt
atggccatcgcctatttcatacccgaccaggcccaattgttggccagaagctatcagcaa
aacggccagcagacagcagcgagtgcaaggacaactgcaacacctgctgcaccaccgcag
cagcagcaacaatcgcaacagcagcagcagcaacaacatcatcagcaacagcgccctcaa
ttccgtgccaatatttccgtgccgctgggaagtcaacagggatcgatgaccatgtcggag
tttggatgctgggatcttttggcgcagatcttctgctacgctctgcgaatctacagctac
agttcgagccagcgacaaccgacggtcattcagatatcattcgaaatcagcagcggcggt
cagaacaacgatgaggacgacgtgaccgatgccacctccaaggaaaactaa

DBGET integrated database retrieval system