KEGG   Drosophila sechellia: 6619304
Entry
6619304           CDS       T01064                                 

Definition
(RefSeq) adenylate cyclase type 3 isoform X1
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
dse  Drosophila sechellia
Pathway
dse00230  Purine metabolism
dse01100  Metabolic pathways
dse04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dse00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    6619304
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    6619304
Enzymes [BR:dse01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     6619304
SSDB
Motif
Pfam: Guanylate_cyc AC_N
Other DBs
NCBI-GeneID: 6619304
NCBI-ProteinID: XP_002043521
FlyBase: FBgn0171056
UniProt: B4IIG1
LinkDB
Position
2L
AA seq 1165 aa
MEENLENGQMTNASTSKSNSQRQTTSRRRQNDSDVAGGVGITGGGVVILPQHVLNELYHN
YSIKQRRSGLKWFVFAAALFNIWTIGIPWDQSAPTRVINCCMLVAYLALTALLYIGCRSG
KPALRRFHQILLIIVPRALWLLSILHFTVYVILQPSFSPRDLLGWAILLNFLVYVTLPLQ
LIFLGLSIGCITYFICLSLPVGYSRWDSLLSNQLAANAVLIATAALIGLLYYFMGEAKQK
RAFLEAKKSLEVKMVIEEQSAEQERLLLSVLPKHVAIKMREDLGSSSSEAFKKIYMSRHE
NVSILYADIVGFTAISSTYSAQDLVKMLNELFARFDRLAEKYQQLRIKILGDCYYCISGA
PDERPDHAVMCVHMGLSMVKAIKYVQQKANSPVDMRVGIHTGAVLAGILGQRQWQFDVYS
KDVELANKMESSGKAGRVHISDKTLAFLNGEFEVEAAFGEKREELLRIAGLKTYFITKVV
KAFASPCAKKINETQSEIAHPNPNGSTTDIVSDEDDNDATLDDEGLLAQNSVSNGHQKVI
AVTADEEEQVKLENFKQRLKDELVTRDGHENLTKDTNIFLRFKNPQLEQLYAVYREPYSS
LPLLAALLVQCIDVLYSYIVLPRSTLHFINIAAPLVPIAMLVVISLAESFSGMLPKFFVD
VSKRFNDITFVRELAAIIIALTIGFSNVIDMFFFVTFVRTEHIVSESEFNVTASLDSDIN
LEGMVTAEHLLPASFVEQMREAVPPERVLYPSYLSNFGVLILIAIAVIAQLTHLTKILLL
LSIAALHCYFNIFIMQDLYALEDDLEHQPIISTRYTASGLLLVAALALSTLARHMDHEDR
VIFKWKTEVAEQKETANDMRQRNEALVYNVLPVHVAEHFMKNTKRSHDDLYSQSYAEVGV
LFASMPNFSDFYSEETVNNQGLECLRFLNEVISDFDALLELPQFQDIIKIKTIGSTYMAA
SGINLHRTLRNDAPITERWSHLAILVEFAMELKHALQSINEQSFNHFVLKMGINHGPITA
GVIGARKPHYDIWGNTVNVASRMESTGKAGAIQVTEETCNILQPFGYKFLQRGLVAVKGK
GQLMTFYLQGKAQSSAEPVSSGAVELNGQDSSALESTSELETSDIKMPLLKMNAPEQSLE
IDQDQSLKNYSAGQERVGEFQSLLE
NT seq 3498 nt   +upstreamnt  +downstreamnt
atggaagaaaatttggagaacggtcagatgacgaacgcctcgacaagcaaatcgaattcg
cagcgtcaaacaacatctcgtcggcggcaaaacgacagcgatgtggccggaggcgtggga
atcaccggtggcggagtcgtcattttgccgcagcacgtgcttaacgaactctatcacaac
tactccatcaaacaacgccgcagtggattgaagtggtttgtctttgcggccgcgttgttt
aacatatggaccatcgggattccctgggatcagtcggcccctacgagagtaatcaattgt
tgtatgctggtagcgtacttggcattgacagcgctcctttacattggatgccgttctggt
aaaccggcactgaggcgcttccaccaaatactcctgattattgtgccacgggcactgtgg
ctattaagcattcttcattttaccgtctatgttattttgcagcctagtttttccccaagg
gacctacttggctgggccatccttctaaatttcttggtctatgtgacgctgccattacag
ctgatttttcttggtctgtcgattggatgtatcacatattttatttgtcttagtctgcct
gttggttattctcgctgggactcgctgctctcgaaccagttagcggccaatgcagtttta
atagccacggcagcgctgataggccttttgtactactttatgggtgaggccaaacagaaa
agagcatttctcgaggccaaaaagagccttgaagttaaaatggtcatagaggaacagtcg
gccgaacaggagcgtctgcttttgtctgtgctgcctaagcacgtggctatcaagatgcgg
gaagatttgggatcatccagttccgaagcctttaaaaaaatctacatgagtcggcacgag
aatgtaagcattctatatgcggatatcgttggctttaccgccatttcctccacatatagt
gcgcaagatttggtaaaaatgcttaatgagctctttgcgcgtttcgacagacttgctgag
aaatatcaacaattgcgcattaagattcttggcgattgctattattgcattagcggtgcc
cctgatgagcgtccagatcacgccgtcatgtgcgtgcacatgggactctccatggtgaag
gccattaagtatgtgcagcagaaggccaactcacctgttgacatgcgagtaggcattcac
actggagccgtgctcgccggcattcttggccagcgacagtggcagtttgatgtttactct
aaggacgtagagctggctaataaaatggaatcgagcgggaaggctggacgcgttcacatt
tcggacaaaacgcttgcctttctgaacggcgaattcgaagtagaggctgcctttggggag
aaacgagaagagttgttgcgtattgctgggctaaagacgtattttatcacaaaagtagtt
aaagcgtttgcatcgccatgtgccaaaaaaataaatgaaacccagtctgaaattgcacac
cccaatcctaatggatcgacgaccgatattgtatcagatgaagatgacaacgatgccaca
ttggacgacgaagggctccttgcgcagaattctgtatctaatggacaccaaaaagtgatt
gcagtgactgcagacgaagaggagcaggtgaaattggagaactttaaacaacgactgaaa
gatgagctggtaactcgcgatggacatgaaaacctaactaaggacactaacatattcttg
cgcttcaaaaacccgcagctggagcaactgtatgccgtatatagagagccgtacagttca
cttccacttcttgccgcccttctagtgcagtgcattgatgtgctgtactcatacatagtt
ctcccgagatctaccctccacttcattaatatagctgctccgttggtaccaatcgcaatg
ctggtagtgatcagccttgccgaaagctttagtggcatgctgccaaagtttttcgtagat
gtcagcaagcggttcaatgacataacttttgttcgcgagctggccgctataattattgca
ctcaccattggcttcagtaacgttatcgacatgttctttttcgtcaccttcgtgcgtacc
gagcatattgtgagtgaaagcgagttcaatgtaacggctagcctagatagcgatataaac
ttggaggggatggtcaccgcagagcacctacttcccgcatcgtttgtggaacaaatgcgc
gaagctgtgcccccggaacgagttttgtatccgtcctacttaagtaactttggagtactt
atattaattgcgattgccgtgattgcccaacttactcatctcacaaagattttgctacta
ttgtccattgcagctttgcattgctatttcaatatattcataatgcaggatctgtatgct
ctagaggatgatttggaacatcaacctattatatctacgcgatataccgcttcaggactt
ctgctagtggctgctctggcgttaagcactttggcaagacacatggaccatgaggatagg
gtaatattcaagtggaaaaccgaggtggccgagcaaaaggagaccgcaaacgatatgagg
cagcgcaatgaggctttggtttacaatgtcttacctgttcatgtggcagagcacttcatg
aagaacactaaacgctctcatgatgatctttattcccagagctatgctgaagtgggcgta
ttattcgccagcatgccgaacttttctgatttctattccgaagaaacagtaaacaaccag
ggcttggaatgtttacgttttctcaatgaggtcatctcagattttgatgcattgttggag
ctgccccaattccaagacatcatcaaaataaaaactattggttcgacatatatggctgcc
agtgggataaatctgcataggactcttcgaaatgacgccccaattacagaacggtggtct
cacctagcgattttggtggagttcgcaatggaactgaagcacgcattgcaaagcatcaac
gagcagtcctttaaccacttcgtccttaagatggggatcaatcatggaccgatcacggct
ggcgttattggcgcacgcaaaccgcattatgacatctggggtaatacggtgaatgtggca
tctcgaatggagagcacaggaaaggcgggtgctattcaggtcacagaagagacgtgcaat
attttacagccctttggttacaaattccttcagcgtggtctggtagcggtcaagggaaaa
ggacagttgatgacattttatctgcagggtaaggcccagtcgagtgctgaaccggtatca
tccggcgcagtcgagctcaatggccaggattcatctgctctagaatccacaagcgaactg
gagacctcagacattaagatgcccttgctgaagatgaatgccccagagcaatcgttggaa
atcgaccaagatcagagtttaaaaaattacagtgctggccaagagagggtgggagaattt
cagtcgttgctagaatag

DBGET integrated database retrieval system