KEGG   Drosophila sechellia: Dsec_GM10321Help
Entry
Dsec_GM10321      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM10321-PA
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
dse  Drosophila sechellia
Pathway
dse00010  Glycolysis / Gluconeogenesis
dse00051  Fructose and mannose metabolism
dse00052  Galactose metabolism
dse00500  Starch and sucrose metabolism
dse00520  Amino sugar and nucleotide sugar metabolism
dse01100  Metabolic pathways
dse01200  Carbon metabolism
Module
dse_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dse_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dsec_GM10321
   00051 Fructose and mannose metabolism
    Dsec_GM10321
   00052 Galactose metabolism
    Dsec_GM10321
   00500 Starch and sucrose metabolism
    Dsec_GM10321
   00520 Amino sugar and nucleotide sugar metabolism
    Dsec_GM10321
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Dsec_GM10321
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dse04131]
    Dsec_GM10321
Enzymes [BR:dse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     Dsec_GM10321
Membrane trafficking [BR:dse04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    Dsec_GM10321
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 6617048
NCBI-ProteinID: XP_002041376
FlyBase: FBgn0165272
UniProt: B4ICL8
LinkDB All DBs
AA seq 453 aa AA seqDB search
MPSLVHTEIETAVKGFLIDQEKMTEVVERMTKEIKMGLAKDTHARSVIKCFVSHVQDLPT
GKERGKYLALDLGGSNFRVLLVNLISSSDVEIMSKGYNFPLTLMSGSGNALFDFLAESLS
EFCHTHGLENESLPLGFTFSFPLQQQGLSKGILVAWTKGFSCEGVVGKNVVSLLQEAIDR
RGDIKINTVAILNDTVGTLMSCAFYHPNCRIGLIVGTGSNACYVEKTVNAECFEGYQTSP
KPSMIINCEWGAFGDNGVLEFVRTSYDKIVDKVTPNPGKQTFEKCISGMYMGELVRLVII
DMIAKGFMFHGIISEKIQERWSFKTAYISDVESDAPGEYRNCNKVLSELGILGCQEPDKE
ALRYICEAVSSRSAKLCACGLVTIINKMNINEVVIGIDGSVYRFHPKYHDMLQYHMKKLL
KPGVKFELIVSEDGSGRGAALVAATAVQAKSKL
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgccgagcctggtgcacacggaaattgagaccgcggtcaagggcttcctgatcgaccag
gagaagatgaccgaggtggtggagcgcatgaccaaggagataaagatgggtctggccaaa
gacacgcatgcgcgatccgtgatcaagtgcttcgtcagccatgtgcaggatctgcccact
ggcaaggagcggggcaagtatttggccctggatctgggtggctccaatttcagggtgctt
ctggtgaacctgataagcagctcggacgtggaaatcatgtcgaagggctacaattttccc
ctgactctgatgtccggatcgggaaatgcgcttttcgactttcttgccgaatccctgtcc
gagttttgccacacccatggactggagaacgaatcactgcctctgggcttcaccttctcg
tttccgctccagcagcagggactctccaagggtatccttgtggcctggaccaaaggattc
agctgcgaaggcgtggtgggcaagaatgtggtgagtctcctccaggaggccatcgatcga
aggggcgatataaaaatcaacaccgtcgccattctcaacgatacggtgggcactctgatg
tcctgcgctttctatcatcccaactgccggataggattgatcgtgggaaccggctccaat
gcgtgctatgtggagaaaacagtaaatgccgaatgcttcgaaggataccagaccagtccc
aagccgtcaatgatcatcaactgcgagtggggcgccttcggagacaatggtgtcctggag
ttcgtgcgaacttcctacgacaagatagtcgacaaggtgacgcccaatcccggcaagcag
acgttcgaaaagtgcatatcgggcatgtatatgggtgaacttgtgcgtttggtcatcatc
gatatgatagccaagggctttatgttccacggcataatttccgagaagatccaggagcgg
tggagctttaaaaccgcctatatttccgatgttgaaagtgatgcacctggcgagtatcgt
aactgcaataaggtacttagcgaactgggcatcttgggctgccaggaacccgacaaagag
gcgctgcgttacatctgcgaggcggtgtcctccaggtctgccaagctatgtgcctgcggc
ctggtcaccatcatcaacaagatgaacatcaacgaggtggtcatcggcatcgacggtagc
gtgtatcgcttccatcccaagtaccacgacatgctccagtaccacatgaagaagctcctc
aagccgggcgtcaagttcgagctgattgtttcggaggacggatccggaagaggagccgct
ctggtggcggccacggcagtccaggccaagagcaaactctaa

DBGET integrated database retrieval system