KEGG   Drosophila sechellia: Dsec_GM15226Help
Entry
Dsec_GM15226      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM15226-PA
  KO
K17550  protein phosphatase 1 regulatory subunit 7
Organism
dse  Drosophila sechellia
Brite
KEGG Orthology (KO) [BR:dse00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dse01009]
    Dsec_GM15226
Protein phosphatases and associated proteins [BR:dse01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dsec_GM15226
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_4 LRR_9 LRR_8
Motif
Other DBs
NCBI-GeneID: 6616764
NCBI-ProteinID: XP_002041101
FlyBase: FBgn0170146
UniProt: B4IBJ1
LinkDB All DBs
AA seq 326 aa AA seqDB search
MGDADRAMNEPEAAKTVSGIQVIPAEDVASIEDIITIDPDCYELDLNHRRIEKLENFEPL
TRIERLFLRWNLIKKIENLSSLKTLIELELYDNQITQIENLDDLTQLEVLDISFNRLTKI
ENLDKLVNLEKVYFVSNRITQIENLEMLTNLTMLELGDNKLKKIENIEMLVNLRQLFLGK
NKIAKIENLDTLVNLEILSLQANRIVKIENLEKLANLRELYVSENGVETIENLSENTKLE
TLDLAKNRLKGIANLEKLELLEELWLNHNGVDDWKDIELLKVNKSLQTIYLEYNPLAKDV
RYRSKLRDILPQLQKIDATLCKVPGT
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgggcgatgctgatcgtgcgatgaacgaaccggaagccgccaaaacggtgtccggaatc
caggtgattcccgccgaggatgtggcttccattgaggatataatcaccatcgatccggac
tgctacgagctcgatctgaatcaccgccggatcgagaagctggagaacttcgagccgctc
actcgtatcgaacgcctgttcctgcgctggaatctgatcaagaagatcgagaacttgtcc
agcctgaaaacactgattgagctggagctatatgacaaccagatcacccagattgagaat
ttggacgacttgacccaactggaggtgctggacatcagcttcaatcgtctgacaaagata
gagaacctggacaagctggtcaatctggagaaggtctactttgtgtcgaaccggataacc
caaatcgagaacctggagatgctcaccaatctgaccatgctggagttgggggataacaaa
ctgaagaagatcgaaaacatcgaaatgctggtgaatctacgacagctcttcctgggcaaa
aataagatagcaaagatcgagaacttggacacactggtcaatttagagatactcagtctg
caggccaaccgcattgtaaaaatcgagaatctagaaaagcttgccaacctccgcgaactc
tacgtttcggaaaacggagtggaaaccattgaaaacctctctgagaacaccaaattggag
accctcgacttggccaagaaccggttgaagggcattgctaatctggagaagctggaactg
ctcgaagagctgtggctgaaccacaacggagtcgatgactggaaggacatagagctgttg
aaggtgaataagtcgctgcagaccatctacctggagtacaatccactggccaaggatgtt
cgctaccgctccaaactgcgcgacatcctgccgcagctgcagaagatcgatgccaccttg
tgcaaggtgcccggtacctag

DBGET integrated database retrieval system