KEGG   Drosophila sechellia: Dsec_GM16058Help
Entry
Dsec_GM16058      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM16058-PA
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
dse  Drosophila sechellia
Pathway
dse03030  DNA replication
dse03410  Base excision repair
dse03420  Nucleotide excision repair
dse03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:dse00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Dsec_GM16058
   03410 Base excision repair
    Dsec_GM16058
   03420 Nucleotide excision repair
    Dsec_GM16058
   03430 Mismatch repair
    Dsec_GM16058
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dse03032]
    Dsec_GM16058
   03400 DNA repair and recombination proteins [BR:dse03400]
    Dsec_GM16058
Enzymes [BR:dse01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Dsec_GM16058
    6.5.1.6  DNA ligase (ATP or NAD+)
     Dsec_GM16058
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Dsec_GM16058
DNA replication proteins [BR:dse03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Dsec_GM16058
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Dsec_GM16058
DNA repair and recombination proteins [BR:dse03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Dsec_GM16058
   NER (nucleotide excision repair)
    Other NER factors
     Dsec_GM16058
   MMR (mismatch exicision repair)
    Other MMR factors
     Dsec_GM16058
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DNA_ligase_OB_2 UPF0128
Motif
Other DBs
NCBI-GeneID: 6615797
NCBI-ProteinID: XP_002040167
FlyBase: FBgn0170974
UniProt: B4I8V7
LinkDB All DBs
AA seq 747 aa AA seqDB search
MQKSITSFFKKKSDATDSPSPPKKVPKIDAKTELPDEPHIKSESASPETKPKVEPMSVDS
EEKTSPVKNVKKEPKDTVDKTTDKKVTTIGLNSTSASKEDAENYDPSADSYHPLKNAYWK
DKKVTPYLALARTFQVIEETKGRLKMIDTLSNFFCSVMLVSPEDLLPSVYLSINQLAPAY
EGLELGVAETTLMKAICKATGRNLAHIKSQTQLIGDLGIVAEQSRVSQRMMFQPAPLNVR
DVFRKLREIAKISGQSKMDLVYNMFVACRLSEARFFIRSLIGKLRIGIAEQSLLTALAIG
LVKKNHIDDCKASKVPEVYKDEIADTTLLLKTAYCQCPNYDIIIPAILKYDIKELQERCP
MHPGMPLRPMLAQPTKGVHEVFERFGGMQITCEWKYDGERAQIHRNEKGEISIFSRNSEN
NTAKYPDLIARSTGLLKGDVKSYIIDSEIVAWDVERKQILPFQVLSTRKRKNVDIEEIKV
QVCVYIFDLLYINGTALVTKNLSERRKLLLEHFQEVEGEWKFATALDTNDIDEVQQFLEE
SIKGNCEGLMVKTLDEEATYEIAKRSRNWLKLKKDYLSNVGDSLDLVVIGGYKGKGRRTG
TYGGFLLACYDTENEEYQSICKIGTGFTDEDLQTHSEFLGKHVTSAAKSYYRYDPSLEPD
HWFEPVQVWEVKCADLSLSPIHRAAIGIVDGERGISLRFPRFIRIRDDKNSENATDANQV
AHMYQSQDQVKNNQKSSTQMEMEDEFY
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagtctataacctccttcttcaagaagaaatccgatgccacagacagcccctcg
ccgcccaagaaagttcccaagatcgatgcgaagaccgaactcccagatgagccccacatc
aagagcgagagtgcctccccggaaactaagcccaaggtagaacctatgtctgtggattcc
gaggagaagacaagtccggtgaagaatgttaagaaggagccaaaggataccgtggacaag
actacagacaagaaggtcacaaccataggtctcaactccacctccgcttctaaggaggat
gcggaaaactacgatccatccgccgactcctatcatccactcaagaatgcctactggaag
gacaaaaaggtcactccctacttggcactggcccgcacatttcaagtaatcgaggagacc
aaaggccgactcaagatgatcgacacgctgagcaacttcttttgctcggtgatgctggtt
agtccggaggatctgttgcccagcgtctacctcagcatcaaccaactggcgcccgcctac
gagggactggagctgggcgttgccgagaccaccttaatgaaggctatttgcaaggccacg
gggcgtaacttggctcacattaaatcacaaacgcagctaatcggggatctgggcatcgtg
gctgagcagtcgcgcgtttcccagcgcatgatgttccagccagcgcccctgaatgtgagg
gatgtgttccggaagctgcgcgaaatagccaagatatccggtcagtcgaaaatggacctg
gtgtacaatatgtttgtggcctgtcgattgtcggaggctcgcttctttatccgttctttg
attggcaagctgagaattggcattgcagagcagagtttgctcacagcgctggccattggg
ctggtgaaaaagaaccacatcgatgactgcaaggctagcaaggtgccggaagtctataag
gatgaaatagcagacaccaccttgctgctgaaaactgcatactgtcagtgtcccaactac
gacatcattataccggccattctaaagtacgatatcaaggagctgcaggaacgctgcccc
atgcatcccggcatgcccctgaggcccatgctcgcacagcccactaagggggtccatgag
gtatttgagagattcggcggcatgcaaatcacctgcgagtggaaatacgatggagagcga
gcccaaatccaccgcaacgagaagggggagatcagcatattctcgcgcaactccgagaac
aacacggcgaagtatccggatttgattgccaggagcactggcctgctcaagggcgacgta
aagtcctacatcatagacagtgaaattgtggcctgggatgtcgagcgcaagcagattctg
ccgttccaggtgctcagcacgcgcaagcggaagaacgttgatatcgaggaaatcaaggtc
caagtctgtgtctacatcttcgatctgttgtacatcaatggcaccgctctggtgaccaaa
aacctgtctgaacgtcgcaaactcctgttggagcacttccaagaggtcgagggcgagtgg
aagttcgccactgctctggacacgaatgacatagacgaagtgcaacagttcctggaggag
tctatcaaaggaaattgcgagggcctcatggtcaaaactttggatgaggaggccacctat
gagattgccaagagatcccgcaactggctgaaattgaagaaggactacctatccaatgta
ggcgactcactcgatttggtggtcattggcggctacaaaggcaagggccggcgaactgga
acctacggaggatttttgcttgcctgctatgacaccgagaacgaggagtatcagagcata
tgcaagattggaacgggtttcactgatgaggacctgcaaacgcattccgagttcttgggc
aagcatgtgaccagcgctgccaaatcctactacagatacgaccccagcctggagcccgat
cactggtttgaaccggtccaggtgtgggaagtcaaatgcgccgatctgtcgctcagtccg
atccaccgagcagccattggcattgtggacggagagcgcggcatttccttgagattccct
cggttcatccggatacgcgacgacaagaacagcgaaaacgcaacggacgccaatcaggtg
gcccacatgtaccagtcgcaggatcaggttaaaaataatcaaaagtcgagcacacagatg
gagatggaggacgagttctactga

DBGET integrated database retrieval system