KEGG   Drosophila sechellia: Dsec_GM17055Help
Entry
Dsec_GM17055      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM17055-PA
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
dse  Drosophila sechellia
Brite
Enzymes [BR:dse01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     Dsec_GM17055
Peptidases [BR:dse01002]
 Metallo Peptidases
  Family M2
   Dsec_GM17055
Exosome [BR:dse04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dsec_GM17055
CD molecules [BR:dse04090]
 Proteins
  Dsec_GM17055
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 Chorion_2
Motif
Other DBs
NCBI-GeneID: 6611716
NCBI-ProteinID: XP_002036249
FlyBase: FBgn0171967
UniProt: B4HYP2
LinkDB All DBs
AA seq 498 aa AA seqDB search
MGACNITVLLLVIMLWLPHGLSMGNSCSASVLEARRFFELENEQLRRRFHEEFLSGYNYN
TNVTEANRQAMIEVYARNAELNKRLAQQIKASDYIQSEDADIRRQAEHLSKLGASALNAD
DYLALQNAISSMQTNYATVTVCSYTNRSDCSLALEPHIQERLSHSRDPAELAWYWREWHD
KSGTPMRQNFAEYVRLTRKASQLNGHRSYADYWVQFYEDPDFERQLDATFKQLLPFYRQL
HGYVRFRLRQHYGPDVMPAEGNIPISLLGNMWGQSWNELLDLFTPYPEKPFVDVKDEMEK
QGYTVQKLFELGDQFFQSLGMRALPPSFWNLSVLTRPDDRQVVCHASAWDFYQDSDVRIK
MCTEVDSHYFYVVHHELGHIQYYLQYEQQPAVYRGAPNPGFHEAVGDVIALSVMSAKHLK
AIGLIENGRLDEKSRINQLFKQALSKIVFLPFGYAVDKYRYAVFRNELDESQWNCGFWQM
RSEFGGVEPPVFPHRKGL
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgggggcatgcaatataacagtcttattgctggtcatcatgttgtggctaccccatggt
ctgtccatgggcaatagctgctcggcatcggtgctggaggcgcgcaggttcttcgaactg
gaaaatgaacaattgcgaaggcgcttccacgaggaattcctgtccggctacaactataac
accaatgtaactgaggcgaaccgccaggccatgatcgaagtgtatgcccgcaatgcagag
ctgaataagcgcctggcgcagcagataaaggcctccgattacattcagtccgaggatgcg
gatatacgacgacaggccgagcacctatccaaactgggtgcatccgccctgaatgccgac
gactacctggccctgcagaatgccatcagttcgatgcagacgaactatgccaccgtcacc
gtgtgctcctacaccaatcgcagtgattgctccctcgccctcgagccgcacatccaggag
cgtctgtcccacagtcgtgatcctgccgaactggcttggtattggcgggagtggcacgat
aagtccggaactcccatgcggcagaacttcgccgagtacgtgcgactgacgcgcaaggca
tctcagttgaatggtcaccgctcctatgccgactactgggtgcagttctacgaggacccg
gactttgagcgacaactggatgccacatttaagcagctgctgcccttctaccgacagctc
cacggctacgttcgttttcgtttgcggcagcactacggtccggatgtgatgccagcggag
ggaaacatacctataagcctgctgggcaacatgtggggtcagtcgtggaacgagctgctc
gatttgtttactccctatccggagaagccgtttgtggacgtgaaggacgaaatggagaag
cagggatatacggtgcaaaagctgtttgagctgggtgatcagttcttccagtcgctcgga
atgcgcgcgctgcctcccagtttctggaatctgagtgtgctcacccgtcccgacgatcgt
caggtggtttgccacgcctccgcctgggacttttaccaagacagcgatgttaggatcaag
atgtgcaccgaagtggacagccactacttttatgtagtgcatcatgagcttggacacatt
cagtactatctgcagtatgagcaacagccggctgtctaccggggagctcccaatcctggc
ttccatgaagctgtgggcgatgtgatagctctatcggtgatgtcggccaagcacttgaag
gccattggtctgatcgaaaatggtagactagacgaaaagagtcgaatcaatcagttgttc
aagcaagccctctccaagattgtcttcctgccctttggctacgccgtggataagtatcgc
tatgccgtttttcgcaatgagttagatgagtcgcaatggaactgcggcttctggcagatg
cgctccgagtttggcggcgtcgagccaccagtatttccgcaccgaaagggactttga

DBGET integrated database retrieval system