KEGG   Drosophila sechellia: Dsec_GM18144Help
Entry
Dsec_GM18144      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM18144-PA
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
dse  Drosophila sechellia
Pathway
dse04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dse00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    Dsec_GM18144
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:dse01002]
    Dsec_GM18144
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dse04147]
    Dsec_GM18144
Enzymes [BR:dse01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     Dsec_GM18144
Peptidases [BR:dse01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   Dsec_GM18144
Exosome [BR:dse04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dsec_GM18144
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986 Peptidase_S32
Motif
Other DBs
NCBI-GeneID: 6613247
NCBI-ProteinID: XP_002037724
FlyBase: FBgn0173051
UniProt: B4I2Z7
LinkDB All DBs
AA seq 277 aa AA seqDB search
MLALRLFVLLQCSLLVLAGVCLIPQPVKRQRSLEDVIKNAWKLSPRLDGRIVGGHRINIT
DAPHQVSLQTSSHICGGSIISEEWILTAAHCTYGKTADRLKVRLGTSEFARSGQLLRVQK
IVQHSQFNYTNVDYDFSLLQLAHPIKFDDTKKAVKLPESQMKFMDGEACFVSGWGNTQNL
LESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSGGPMVSESG
ELVGVVSWGYGCAKPDYPGVYSRVSFARDWIKEHSGV
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgttggctctccgcttgtttgtactgctgcagtgcagcctgttggttctggctggcgtt
tgtttaataccacagcccgttaaaaggcagcgatcgcttgaggatgttataaaaaatgcc
tggaagctatcaccccgcctggatggccgcattgtgggcggtcaccgcatcaacatcacc
gatgcaccacatcaggtttcgctgcagacctcgtcccatatctgcggaggttctattata
tctgaggagtggatattgactgccgcccattgcacatatggtaaaacggcagatcgcctg
aaagtacgcctcggaaccagcgaattcgctcgcagtggccaactgctgcgggtgcagaag
atcgtccagcactcccagttcaactacaccaatgtggattacgatttctcgctacttcag
ctagctcatcccatcaagtttgacgacaccaaaaaggccgtaaagctgcccgagtctcag
atgaaattcatggacggggaagcctgcttcgtgagtggttggggcaacacccagaacctg
ctggagtcccgcgagtggctgcgtcaggtggaggtgcctctggtcaatcaggagctgtgc
agcgagaagtacaagcagtacggcggcgtcaccgagcgaatgatctgtgctggatttctg
gaaggcggaaaggatgcgtgccaaggcgattccggcggtccgatggtcagtgaatcgggc
gagctggtgggcgtggttagctggggctacggctgcgctaagcccgactatccgggtgtc
tactcaagagtgagtttcgcacgggattggatcaaggagcacagtggtgtttag

DBGET integrated database retrieval system