KEGG   Drosophila sechellia: Dsec_GM19835Help
Entry
Dsec_GM19835      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM19835-PA
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
dse  Drosophila sechellia
Pathway
dse00020  Citrate cycle (TCA cycle)
dse00190  Oxidative phosphorylation
dse01100  Metabolic pathways
dse01200  Carbon metabolism
Module
dse_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dse_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dse_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:dse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dsec_GM19835
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Dsec_GM19835
Enzymes [BR:dse01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Dsec_GM19835
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA DAO FAD_binding_3 HI0933_like TBK1_CCD1
Motif
Other DBs
NCBI-GeneID: 6609931
NCBI-ProteinID: XP_002034581
FlyBase: FBgn0174721
UniProt: B4HPF6
LinkDB All DBs
AA seq 636 aa AA seqDB search
MSGIMRVPSILAKNAVASMQRAAAVGVQRSYHITHGRQQASAANPDKISKQYPVVDHAYD
AIVVGAGGAGLRAAFGLVAEGFRTAVITKLFPTRSHTIAAQGGINAALGNMEEDDWKWHM
YDTVKGSDWLGDQDAIHYMTREAPKAVIELENYGMPFSRTQDGKIYQRAFGGQSLKFGKG
GQAHRCCAVADRTGHSLLHTLYGQSLSYDCNYFVEYFALDLIFEDGECRGVLALNLEDGT
LHRFRAKNTVIATGGYGRAFFSCTSAHTCTGDGTAMVARQGLPSQDLEFVQFHPTGIYGA
GCLITEGCRGEGGYLINGNGERFMERYAPVAKDLASRDVVSRSMTIEIMEGRGAGPDKDH
VYLQLHHLPPKQLAERLPGISETAMIFAGVDVTREPIPVLPTVHYNMGGVPTNYRGQVIT
IDKDGKDVIVPGLYAAGESASSSVHGANRLGANSLLDLETAGEASVANFDKLRHANGQIT
TADLRLKMQKTMQHHAAVFRDGPILQDGVNKMKEIYKQFKDIKVVDRSLIWNSDLVETLE
LQNLLANAQMTIVSAEARKESRGAHAREDFKVREDEYDFSKPLEGQQKKPMDQHWRKHTL
SWVCNDNGDITLDYRNVIDTTLDNEVSTVPPAIRSY
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgtccggaatcatgcgcgtgccatcgattttggccaaaaatgcagtcgcctccatgcaa
cgtgccgcagccgttggagtgcagcgcagttaccacatcacacacggccgccagcaggcc
tcggcggcgaatccggacaagatatcgaagcagtacccggtggtggatcacgcctacgat
gcgatcgtcgtgggagcaggaggagccggcttgcgggcggcttttggcctggtggctgag
ggattccgcacggcggtgatcaccaagctgttccccacccgctcgcacacgatcgccgca
cagggcggtatcaatgcagctctgggcaacatggaggaggacgactggaagtggcacatg
tacgacacggtcaagggctccgattggctgggcgaccaggatgccatccactacatgacg
cgcgaggcgcccaaggctgtcatcgagctggagaactacggcatgccattctcacgtacc
caggacggaaagatctaccagcgcgccttcggtggacagagtctgaagttcggcaagggc
ggtcaggcccatcgctgctgtgctgtggctgatcgtactggtcactcgctgctgcacacg
ctctacggtcaatcgctgagctacgactgcaactactttgtggagtactttgccctggat
ctgatcttcgaggacggcgagtgccggggtgtgctggccctgaacctggaggatggcaca
ctgcaccgattccgcgctaagaacacggtcattgccaccggcggatatggacgcgccttc
ttctcctgcacatcggcgcacacatgtaccggtgacggtaccgccatggttgcccgccag
ggactgccctctcaggatctggagttcgtgcagttccatcctactggcatctacggcgcc
ggctgtctcatcaccgagggctgccgcggtgagggtggttacctgatcaacggtaatggc
gagcgcttcatggagcgctatgctcctgtggccaaggatctggcctcccgcgacgtcgtc
tcgcggtcgatgaccatcgagatcatggagggtcgtggcgctggacccgacaaggatcac
gtgtacctgcaactgcaccacttgccgcccaagcagctcgctgagcgtctgcctggcatc
tccgagaccgccatgatcttcgccggtgttgatgtgacccgcgagcccatccccgtgttg
cccaccgtgcactacaacatgggcggtgtgccgaccaactatcgcggccaggtaatcacc
attgacaaggatggcaaggatgtgattgtgccgggactgtatgccgctggtgagtctgct
tccagctcggtgcatggtgccaaccgtctgggtgccaactctctgctggatctggaaacc
gctggtgaggcgtctgttgctaacttcgataagctgcgccatgctaacggccagattacc
accgctgatctgcgtctgaagatgcagaagaccatgcagcatcatgctgctgtgttccgc
gatggtcccatcctgcaggacggtgtgaacaagatgaaggagatctacaagcagttcaag
gacatcaaggttgtcgataggtcgcttatctggaactctgatctggtggagacgctggag
ctgcagaacctgttggccaacgcccagatgactattgtgagcgctgaggcgcgcaaggaa
tcgcgaggtgcccacgcccgtgaggactttaaggttcgcgaggatgaatacgatttcagc
aagcccctcgagggtcagcagaagaagcccatggaccagcattggcgcaagcacacgctc
tcgtgggtgtgcaatgacaacggagacattacgctggactacagaaacgtgatcgatacc
acgctggacaacgaagtctctactgttccaccagcgattcgctcctattaa

DBGET integrated database retrieval system