KEGG   Drosophila sechellia: Dsec_GM20055Help
Entry
Dsec_GM20055      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM20055-PA
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
dse  Drosophila sechellia
Pathway
dse00620  Pyruvate metabolism
dse01100  Metabolic pathways
dse01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dsec_GM20055
Enzymes [BR:dse01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     Dsec_GM20055
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Malic_M malic
Motif
Other DBs
NCBI-GeneID: 6609447
NCBI-ProteinID: XP_002034132
FlyBase: FBgn0174938
UniProt: B4HSY1
LinkDB All DBs
AA seq 633 aa AA seqDB search
MQKSPRMSRLSDEKKKMKEDEKKEEAEVDLEKNKELKCVSNYDKTEILDYMPRYMDTFWK
MDTRLSGSKVNGLWMLNQSNYNKGLAFTLNERRVLSIHGLLPVAVRTMGEQVQVCKNLLA
TFTDNVQQYIYLTYLSRRNRRLFYFLLLSDPDRYVPMTDASGSLDLLTVHRMLHSMGQGL
YICIKDLGHVSQILCNWPHRCVRCLLVSNGASVLSVGDLGVDEMPILFSNLHQNVVYGGI
HPAYCLAVMLDVGTNNEELLQDPMYTGLKERRCSEKLYDQLFEEFTLSVMQQYGPRALIL
CKDFEAQKAKKQLELYRARQCIVDVDFQCFAAVALAGVIVCNRLKRVFFSSNVFLFYGAE
AINIGMARLCMVLLKREGLIEMKAREKIWFFDANGLIVLGRKDIPEELLEFANQRDPILD
LVEAIQELKPNILVGGSSLPNTFTPDVLRAMEKSADQPVIFALSRPLEQAECSAEDAFSY
TKGHCIFISGSKLPPLKYANKWYQPGHCTSSYLVAGISCGVILAGFTTIPDEAFCVAAER
LASLVWPCDLEKRNVYPPMRKIQCISLQIAEAIFTYAFGRGLATLYPQPENPMEYIKNSM
YNPEYRMNIVDVYCMQNRSIATTESRKYYTLDI
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagtcgcccaggatgagccgcctgtcggacgaaaaaaagaaaatgaaggaggat
gaaaagaaggaggaggcggaagtagacttggagaagaacaaggagctaaagtgcgtgagc
aactatgacaagaccgagatactcgactatatgccccgatatatggacaccttctggaaa
atggacacccggctgagcggatcgaaggtgaatggtctatggatgctcaaccagtccaac
tacaacaagggactggccttcacgctgaacgaaagacgtgtgctgtccattcacggacta
cttccggtggcagtgcgaacaatgggtgaacaggtgcaggtctgcaaaaatctcctcgcg
acatttaccgataacgtgcaacagtatatatatctgacctatctgtctcgtcgaaatagg
cgactattctacttccttttgctgtccgatcccgatcgctatgtgcccatgacggatgcc
tcgggctcgttagatctgctaacggtccacaggatgctccactcgatgggtcagggtctg
tacatttgcattaaggatctggggcacgtgtcgcaaatcctgtgcaattggccacaccgc
tgcgttcgctgcctgctggtgagcaatggtgcctctgttctgagtgtgggtgacttgggt
gtcgatgagatgcccatactgttctccaacttgcaccagaatgtggtctatggcggcatt
catccggcttattgtttggccgtaatgttggatgtgggcaccaacaacgaggaactgttg
caagatccgatgtatacgggcctgaaggagcgccgttgctcagagaaactgtacgaccag
ctgttcgaggaattcacactgtccgtgatgcagcagtatggaccacgtgccctgatcctg
tgcaaggactttgaggcccagaaggccaagaagcaattggagctgtaccgcgcacgccag
tgcatcgtggacgtggactttcagtgcttcgctgcagttgctctggccggcgtgattgtc
tgcaaccgattgaagagagtcttcttctcctccaacgtattcctgttctacggcgccgaa
gccataaacattggcatggctcgattgtgtatggtcctgctgaaacgtgagggtctcatc
gaaatgaaggccagggagaagatttggttcttcgatgccaacggattgatagtactgggc
aggaaggacataccggaagagctgctggaatttgccaaccaaagggatccgatcctcgat
ctggttgaggccattcaggagctgaagcccaacatactggtgggtgggtcatcactgccg
aatacttttacccccgatgtcctgcgtgccatggagaagagcgccgatcaacctgtgata
tttgcattatcaagacccctagagcaagccgagtgctctgcggaggatgccttctcctac
acgaagggtcattgcatcttcatctcgggttcgaagcttcccccgctgaagtatgccaac
aaatggtatcagccgggtcattgcactagtagctatttggtagctggaataagttgcggc
gtgatcttggccggattcaccaccattccggatgaggcattctgcgtggccgccgagcgt
ttggccagcttggtctggccctgtgacctggagaagcggaatgtgtatccgccgatgagg
aagatccagtgcatcagcctgcagattgccgaggccatattcacgtacgcctttggacgc
ggcctggccactttgtatccgcagccggaaaacccaatggaatacatcaagaactcgatg
tacaacccggagtaccgaatgaacatcgttgacgtttactgcatgcaaaaccgtagtatc
gccaccacggaatcccgcaagtactacacgcttgatatctag

DBGET integrated database retrieval system