KEGG   Drosophila sechellia: Dsec_GM21035Help
Entry
Dsec_GM21035      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM21035-PA
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
dse  Drosophila sechellia
Pathway
dse00052  Galactose metabolism
dse00500  Starch and sucrose metabolism
dse01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Dsec_GM21035
   00500 Starch and sucrose metabolism
    Dsec_GM21035
Enzymes [BR:dse01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     Dsec_GM21035
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase DUF4635
Motif
Other DBs
NCBI-GeneID: 6608183
NCBI-ProteinID: XP_002032928
FlyBase: FBgn0175916
UniProt: B4HRX8
LinkDB All DBs
AA seq 579 aa AA seqDB search
MTTWNSLFLLLGLGLLAVDAAAPWWKNASFYQIYPRSFKDSDGDGIGDLNGVTEKLEYLK
EIGVTATWLSPFLKSPMADFGYDISDFKAVDPLFGSMEDFENMVSRAKELGVKIILDFVP
NHSSDECDWFLRSAAGEEEYKDYYIWHPGFLDEDGNRRPPTNWVSVFRGSAWEWHEGRQE
YYLHQFHKKQPDFNFRNPVVREEMNNVLRFWLEKGVDGFRVDAIYHAFEIEADENGNYLD
EPRNDWTNDPDEYGYTHKIYTVDQPETPHLVYEWRQILEQFQADNGGDERILMVETWSPI
EIVMHYYGNETADGAQIPFNFQLISNLHYDSDAYHYEYLINNWLNLMPEGKSANWVIGNH
DKNRVGSRFGADRVDLFNILLLTLPGCSITYQGEELGMLDGYVSWKDTVDPQACNCYEEN
YMDNSRDPARTPMHWSDETMAGFTTGKSTWLPVSTDYRQRNVKTERGVSLSHLNVFKRLQ
QLRQEPSIEEGSAEVKAVSNYVLAVKRHLSGDFVYISLFNIFDSIENVNLSNVFGSLPAK
FQYALVTEKSIKKVGDQVSAGSVTLMPHEAIVLRSTTTA
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgaccacttggaatagcttgttcctgcttttgggccttggccttctggccgtcgatgcc
gcggcaccctggtggaagaacgcttccttttaccagatctacccgcgatccttcaaagac
agcgacggagatggaatcggagacttaaacggagtgactgagaagctagagtacctcaag
gagatcggtgtgactgccacctggctgtctccttttctaaagtccccgatggccgacttc
ggctacgatatttccgattttaaggcggtcgatcctctttttggttcgatggaggacttc
gagaatatggtatcccgcgccaaggagctgggtgtcaagattattctcgacttcgtgccc
aatcattccagtgatgagtgcgactggttccttcgttcggctgccggcgaggaggagtac
aaggactactacatctggcacccgggattcctcgatgaggacggaaaccgtcgcccgccc
accaactgggtgagcgtcttccgaggcagcgcatgggagtggcacgagggtcgccaggag
tactacctgcatcaattccacaagaagcagccggacttcaacttccgtaatcccgtggtg
cgcgaggagatgaacaacgtgctgcgattctggctggaaaaaggcgtcgacggtttccgc
gtggatgccatctaccacgcctttgagattgaggccgacgagaatggaaactatctggat
gagccccgcaacgattggaccaacgatccagatgagtacggatacacccacaagatctac
actgtggatcagccagagactccgcacttggtatacgaatggcgccaaattcttgagcag
ttccaggctgacaatggcggtgatgagcgcattttgatggtggagacctggtcccccatt
gaaatcgtaatgcattactatggcaacgaaaccgccgatggagcccagataccgttcaac
ttccagctgataagcaatctgcactacgattccgatgcctatcactacgagtacttgatt
aacaactggcttaatctgatgcccgagggcaagagcgccaactgggtgatcggtaaccat
gacaagaaccgtgtgggctctcgattcggagccgatcgagttgacctcttcaacatcctg
ctgctcactctgcccggctgcagcatcacgtaccagggtgaggagctgggcatgctcgac
ggatatgtgtcctggaaggacaccgtggatccgcaagcctgcaactgctacgaggaaaac
tacatggataactcccgtgacccagcccgcactccgatgcactggtcggatgagacgatg
gctggattcaccactggcaagagcacctggctgccggtgtccacggattatcgccagagg
aacgtcaagaccgagcgcggcgtgtccttgagccacctgaacgtgttcaagcgtctgcag
cagctccgccaggagcccagcattgaggaaggatccgccgaggtcaaggctgttagcaac
tacgtcctggccgtcaagcgccacctgagcggcgacttcgtgtacatctctctcttcaac
atcttcgactccatcgagaatgtgaacctgtccaatgtgtttggcagcctgcccgccaag
ttccagtacgccctggtcaccgagaagtccatcaagaaggtcggcgaccaggtgtccgcc
ggcagcgtcaccctcatgccccacgaggccattgtgctgcgttccacaacaactgcttag

DBGET integrated database retrieval system