KEGG   Drosophila sechellia: Dsec_GM23911Help
Entry
Dsec_GM23911      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM23911-PA
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
dse  Drosophila sechellia
Pathway
dse00040  Pentose and glucuronate interconversions
dse00051  Fructose and mannose metabolism
dse01100  Metabolic pathways
Module
dse_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dsec_GM23911
   00051 Fructose and mannose metabolism
    Dsec_GM23911
Enzymes [BR:dse01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     Dsec_GM23911
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 6606897
NCBI-ProteinID: XP_002031691
FlyBase: FBgn0178776
UniProt: B4HIN0
LinkDB All DBs
AA seq 360 aa AA seqDB search
MATDNLTAVLHGIEDLRLEQRPIPEIADDEVLLAMDSVGICGSDVHYLAHGRIGDFVLTK
PMIIGHEAAGVVAKLGKNVTTLKVGDRVAIEPGVPCRYCDHCKQGQYNLCADMVFCATPP
YDGNLTRYYKHAADFCFKLPDHVSMEEGALLEPLSVGVHACRRAGVGLGSKVLILGAGPI
GLVTLLAAQAMGASEILITDLVQQRLDVAKELGATHTLLLQRDQPAEETVKVVHQTMSEV
PDKSIDCCGAESSARLAIFATRSGGVVVVVGMGAPEVKLPLINALAREIDIRGVFRYCND
YSAALALVASGKVNVKRLVTHHYDIMETAEAFETSRRGTGGAIKVMIHVQPRDANNKVKF
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggcaacagacaatttaacagctgttctccacggcatcgaggacctgcgattggagcaa
cgcccaattccggaaatcgccgacgatgaggttcttctggccatggacagcgtgggcatc
tgcggatccgacgtgcactaccttgcccacggacgcatcggtgactttgtgctgaccaag
ccgatgatcattggccacgaggcagccggcgtggtggccaagctgggcaagaatgtgacc
accctcaaggtgggcgaccgcgtggccattgagccgggagtgccctgccgctactgcgat
cactgcaaacaggggcaatacaacctgtgtgccgacatggtcttctgtgctacacctccg
tacgatggaaacctgaccaggtactacaaacacgccgccgacttctgcttcaagctgccg
gatcacgtcagcatggaggagggagccctgctggagccactgtccgtgggagttcacgcc
tgtcgtcgcgcaggagtcggtctgggctcaaaggtgctcattctgggcgctggtccaatt
ggtttggttaccctgctggctgcccaagccatgggtgcctctgagattctcatcactgat
ctggtgcagcagcgtttggatgttgccaaggagctgggcgccacacacacgttgctcctg
cagcgggatcagcccgccgaggagaccgtcaaggtggttcaccagacgatgagcgaggtg
ccggacaaatccatcgactgctgtggagccgagagcagcgcacgcctggccatctttgcc
actcgctccggcggagtagtagtggttgtgggcatgggagctcccgaggtcaagctgcct
ctgatcaacgctttggcacgtgagatcgacattcgtggcgtcttccgctactgcaatgac
tattccgccgctttggctctggtggcttcgggcaaggtgaacgtgaagcgtctagtgacg
caccactacgacatcatggagacggctgaggcgtttgagacctcccgccgcggcaccgga
ggcgctatcaaggtcatgatccacgtccagccgagggacgcgaacaacaaagtcaagttc
tga

DBGET integrated database retrieval system