KEGG   Drosophila sechellia: Dsec_GM24804Help
Entry
Dsec_GM24804      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM24804-PA
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
dse  Drosophila sechellia
Pathway
dse00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:dse00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    Dsec_GM24804
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dse03036]
    Dsec_GM24804
Enzymes [BR:dse01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Dsec_GM24804
Chromosome and associated proteins [BR:dse03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     Dsec_GM24804
   Polycomb group proteins
    PRC2-EZH2 complex
     Dsec_GM24804
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 6605167
NCBI-ProteinID: XP_002030006
FlyBase: FBgn0179666
UniProt: B4HLW0
LinkDB All DBs
AA seq 753 aa AA seqDB search
MNSTKVPPEWKRRVKSEYIKIRQQKRYKRADEIKEAWIRNWDEHNHNVQDLYCESKVWQA
KPYDPPHVDCVKRAEVTSYNGIPSGPQKVPICVINAVTPIPTMYTWAPTQQNFMVEDETV
LHNIPYMGDEVLDKDGKFIEELIKNYDGKVHGDKDPSFMDDAIFVELVHALMRSYSKELE
EAAPGTSTGIKTETLAKSKHGEDDAEVDVDVDGVSPIKLEKTDSKVDLTVVEKKENDEPE
ETEDADIKPAVEEVEDKLPFPAPIIFQAISANFPDKGTAQELKEKYDPERPQECTPNIDG
IKAESVSRERTMHSFHTLFCRRCFKYDCFLHRLQGHAGPNLQKRRYPELKTFAEPCSNSC
YMLIDGMKEKLAADSKTPPIDSCNEASSEDSNDSNSQFSNKDFNHENSKDNGLTVNSAAV
AEINSIMAGMMNITSTQCVWTGADQALYRVLHKVYLKNYCAIAHNMLTKTCRQVYEFAQK
EDAEFSFEDLRQDFTPPRKKKKKQRLWSLHCRKIQLKKDSSSNHVYNYTPCDHPGHPCDM
NCSCIQTQNFCEKFCNCSSDCQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCQACGADQ
FKLTKITCKNVCVQRGLHKHLLMAPSDIAGWGIFLKEGAQKNEFISEYCGEIISQDEADR
RGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSINPNCYAKVMMVTGDHRIGIFAK
RAIQPGEELFFDYRYGPTEQLKFVGIEREMEIV
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atgaatagcactaaggtgccacccgagtggaagaggcgtgtcaagtcggagtacatcaaa
atcaggcagcagaagcgctacaaacgtgccgacgagatcaaggaggcgtggataaggaac
tgggacgagcacaaccacaatgtacaggatctgtactgcgagtcgaaggtttggcaggct
aaaccctacgacccgccgcatgtggactgcgtgaagcgggcggaggtgactagctacaat
ggcattcccagcggtccccaaaaggtacctatctgcgtgatcaacgcggtcactcccata
cccaccatgtatacgtgggcaccaacacagcagaacttcatggtggaagatgagacggtg
ctgcacaatataccctatatgggcgacgaggtcctcgataaggatggcaagttcatagag
gaactgatcaaaaactacgatggcaaggtccacggcgacaaggatccctcgttcatggac
gatgccatcttcgtagaactggtgcacgccctaatgcgctcctatagcaaggaactggag
gaagccgctccgggtacatcgactggcattaaaacagagacgttggcaaaatcaaaacat
ggcgaagatgatgcagaagtggatgtagacgtagacggtgtatctcccataaagcttgag
aaaaccgacagcaaagtggatctgactgtggttgagaagaaggaaaatgatgaaccggag
gagactgaagatgcggatattaagcccgctgtggaagaagtcgaggacaagctgcccttc
cctgcccccattatttttcaggccatcagcgccaactttccagacaagggcactgctcaa
gagctcaaagaaaagtatgatccggagcgtccacaggagtgcacacccaacatagacggc
atcaaggccgaaagcgtttcacgggaaaggaccatgcactcctttcacacgctcttctgt
cggcgttgcttcaaatacgactgcttcctgcaccgcttgcaaggacatgcgggtcccaat
ctgcagaagcgtcgctatccggaactgaagaccttcgccgaaccttgcagcaactcctgc
tacatgttgatcgatggcatgaaggaaaagctggcggccgatagcaagacacctcccatt
gattcctgcaatgaggccagctccgaggacagcaatgacagcaacagtcagttcagcaac
aaggactttaaccatgagaatagcaaggataatggcctgactgtaaatagcgccgctgtg
gctgagatcaactccattatggctggcatgatgaacatcaccagtacgcagtgcgtctgg
actggcgctgaccaagctctttatcgggtcttgcataaagtgtatttaaagaactactgc
gcgattgcacacaacatgctcacaaagacctgccgtcaggtgtacgagtttgcccagaag
gaggacgctgagtttagtttcgaggacttgcgacaggacttcacaccgccgcgcaagaag
aagaagaagcaacgtctgtggtcgctgcactgccgtaagattcagctgaagaaggactca
tcctcgaatcacgtgtacaactacacgccctgcgaccatcccggacatccctgcgacatg
aactgctcctgcattcaaacgcaaaacttctgcgagaagttctgcaactgcagcagcgat
tgccagaatcgtttcccaggctgtcgctgcaaggctcagtgcaatacgaagcagtgtcct
tgctatctggcggttcgcgagtgcgatcccgatctctgccaggcctgcggagcggatcag
tttaagctgaccaagatcacgtgcaagaacgtgtgcgtgcagcggggactgcacaaacac
ctgctcatggccccctctgacatcgccggatggggcatctttcttaaggaaggtgcacaa
aagaatgagttcatatcggaatattgtggcgagatcatatcccaagatgaagccgatcgc
cgtggcaaggtctacgacaagtacatgtgctcgttccttttcaatctgaacaacgatttt
gttgtggatgccactcggaagggcaacaagattcggtttgccaatcattccattaatccc
aattgctatgccaaggttatgatggtcaccggcgatcatcgcatcggcatctttgccaag
cgggccattcagcccggcgaggagctcttctttgactacagatatggacccacggaacag
ctgaagttcgtgggcatagagcgtgaaatggaaattgtttga

DBGET integrated database retrieval system