KEGG   Drosophila sechellia: Dsec_GM25061Help
Entry
Dsec_GM25061      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM25061-PA
  KO
K00310  pyrimidodiazepine synthase [EC:1.5.4.1]
Organism
dse  Drosophila sechellia
Pathway
dse00480  Glutathione metabolism
dse00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:dse00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Dsec_GM25061
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dsec_GM25061
Enzymes [BR:dse01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.4  With a disulfide as acceptor
    1.5.4.1  pyrimidodiazepine synthase
     Dsec_GM25061
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_C_3 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 6604889
NCBI-ProteinID: XP_002029734
FlyBase: FBgn0179922
UniProt: B4HJJ6
LinkDB All DBs
AA seq 241 aa AA seqDB search
MSAGKHLAKGSPKPVLPDDGVLRLYSMRFCPYAHRAHLVLNAKNVPHHSVYINLTEKPEW
LVEVSPLLKVPALQLVAEKGEPSLIESLIIAEYLDDKYPENPLLPKDPLGRAQDKILLER
FSGITSAFMKILLQGTGLDDFWTALEIFEEELTKRGTPYFGGNKPGFVDYMIWPWFERLS
VIELKLQKEYNFNESRFPKISKWIPLLKADSVVQSFYVTPEQHNEFWRTRATGKANYDLL
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctggtaaacatttggccaaaggttcccccaagcctgtcctccctgacgatgga
gtcctccgcctgtactccatgaggttctgcccctacgctcaccgagcccatctcgtcctg
aacgccaagaatgtgccccatcacagcgtctacatcaatctcaccgagaaaccagagtgg
ctggtggaagtgagtccgttgcttaaggtgcctgccctgcagctggtggcggagaagggt
gagccctcgctcatcgagtcgctgattattgccgagtatctggacgacaagtacccggag
aatccgctgctgcccaaggacccattagggcgggcccaggacaagatcctgctggagcgc
ttcagcggcatcaccagtgccttcatgaagatcctcttgcagggcaccgggctggatgat
ttctggacggcacttgaaatctttgaggaggagttgaccaagcggggcaccccatacttt
ggcggcaacaagcccggcttcgtggactacatgatctggccctggttcgaacgcctctct
gtaatcgagttgaagttgcagaaggagtacaacttcaacgagagtcgcttccccaagatc
agcaagtggattcccctcctgaaggcggactcggtggtgcagtccttctatgtcactccc
gagcagcacaacgagttctggcgcacccgcgcgaccggcaaggcaaactacgatctgctg
gcttag

DBGET integrated database retrieval system