KEGG   Drosophila sechellia: Dsec_GM26624Help
Entry
Dsec_GM26624      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM26624-PA
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
dse  Drosophila sechellia
Pathway
dse00052  Galactose metabolism
dse00500  Starch and sucrose metabolism
dse01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Dsec_GM26624
   00500 Starch and sucrose metabolism
    Dsec_GM26624
Enzymes [BR:dse01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     Dsec_GM26624
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C
Motif
Other DBs
NCBI-GeneID: 6617669
NCBI-ProteinID: XP_002041985
FlyBase: FBgn0181477
UniProt: B4IE25
LinkDB All DBs
AA seq 1044 aa AA seqDB search
MVVVKIAFILSVGLVGILAHNHQSKELDAKYNWWQHEVFYQIYPRSFQDSNGDGIGDLQG
ITSRLQYFKDTGITSVWLSPIYDFGYDISNYTNIQPEYGTLEDFDALIAKANELVVKVIL
DFVPNHSSNKHPWFIKSGTTDDPNNEAYLSHIYTRNQPEDYGLLQHWRQLLYNYTANHEG
PPRIMMTKGYASVSKLMEHYEDSNGVQGPQFPFNFDFITELNANSTAADFVFYISRWLIY
MPHGHVANWVMGNHDNPRVASRFGEKSVDAMNMLLMTLPGIGITYNGEELGMTDYRDISW
TDTVDQPACEAGIDNYKTISRDPERTLIQWNSDLNAGFSSANRTWLPVNPNYKELNLRNQ
QQARRSHYKIYQSLLKLRQLPFLKNGSFDPEVVNRRVFAFKRELKNEHTLLTIVNVSNRT
ELVDIADFIDQPNRLSVLVAGVDSQHRVGDRLKAEAIELAPNEGLVIQLNKRNLLNSGSI
MAGLVKSDTEDFIDWWQHTVFYQIYPRSFMDSNGDGIGDLKGITSKLRYLADTGITATWL
SPIFQSPMVDFGYDISDYKAIQPEYGTMADFEELIDTAFELGIKVVLDFVPNHSSDQHEW
FKKSASREPGYEDFYVWHDGIVQKNGTRVPPNNWPSVFYGSAWKWHEGREQYYLHQFTKE
QPDLNFRNPKVVQAMDDVLLFWLNKGVAGFRIDAVNHLFEDESLKDEPLSGKTGDSLSYD
YTEHIYSRDLPEVLEMIHHWRQLLDDFSAKHPERPTRIMMTEAYAGLTQLADYYEDSNGV
RGSHLPFNFHFITDVTGDSDARDYVYNVEKWLIYMPRGHAANWVMGNHDNPRVASRFGPA
SVDAMNMLLLTLPGVAVTYNGEELGMVDYRELSWEDTVDPPARNVGEELYQEVSRDPVRT
PFQWSNETNAGFSTATKTWLPVHPNYLELNLEAQKVANRSHYHVYKDLLELRKSAIMRVG
RFNIEPLTRWVFAFKRSYPNFESIITVINVSDKEQLVDLSEFLSHPKKLVVEVSGVDSKY
QPGQSLAASALLLAAREGLVCRLV
NT seq 3135 nt NT seq  +upstreamnt  +downstreamnt
atggttgtagtgaaaatagctttcattttgagtgtgggcctagtaggcatattggcccac
aaccaccagtcaaaggagctggatgcgaaatataattggtggcagcacgaggtcttctac
cagatctatccgagatcctttcaggacagcaatggcgatggtattggtgatcttcaagga
attacgtctaggttgcagtattttaaggatacgggcatcacgtccgtatggttgagtccc
atttatgactttggatacgatatatctaactatacaaacatacagccggaatatggcacc
cttgaggactttgacgccctgatagccaaggccaatgaactggtcgtgaaggtcatcctg
gactttgttcccaatcacagctcgaataagcatccctggttcataaagagtggcactacc
gatgatccgaataatgaggcctacttgagccacatctataccagaaatcagcctgaggat
tacggcctccttcagcattggcggcaacttctgtataattatacagctaaccacgagggt
ccacctaggataatgatgaccaagggttacgcttcggtgtcgaaattaatggaacactac
gaagattccaatggagttcagggtcctcagtttcctttcaacttcgacttcatcactgaa
ctgaatgccaattcgacagctgcggactttgtcttctatatctccaggtggcttatctat
atgccacatggtcatgtggccaactgggtgatgggaaatcacgacaatcctcgagtggca
tcacgatttggtgagaaatctgtggacgccatgaatatgctgctgatgacactgccagga
attggtattacttataatggcgaggagttgggcatgactgactacagggacatcagctgg
actgatacggtggatcagcccgcttgtgaggctggaatcgacaactacaagacaatctct
agagatcccgagcgaactctcatacaatggaatagtgatctaaatgcaggattctcatcc
gccaaccgcacttggttgcctgtcaatcccaattataaggaactaaatcttcggaatcag
cagcaggcgaggcgaagtcattacaagatctatcagtcccttctgaagctcagacaactg
ccatttctgaagaacggatcctttgatccagaagtggttaatcgcagggtcttcgctttc
aagcgagaactgaagaacgagcacactctcctgaccatcgtgaacgtgagcaaccgcact
gaactggtggacatcgctgactttatagatcagcccaatcgattgagtgtccttgtggcg
ggagtggactcacaacaccgggtgggggatcgacttaaggccgaagctattgaattggcg
cccaacgagggattagttattcagctgaataagcgaaatctgctgaactccggctccatt
atggccggtctggtgaagagcgatacggaggactttatcgactggtggcaacacacggtc
ttctatcagatctacccgaggtccttcatggacagcaatggcgatggcatcggcgatctg
aagggaatcacctccaagctgcgctatctggcagacactggcatcacggccacctggttg
agtcccatttttcagtcgcctatggttgactttggctatgatatatcggattacaaggca
atccagccggagtatggcaccatggcggatttcgaggagctgatcgacacggccttcgaa
ctgggcattaaggttgttctggactttgtgccgaatcacagctcggatcagcatgagtgg
ttcaagaagtctgcgtccagagagccgggttacgaggatttctatgtgtggcacgatggc
atcgtacagaagaatggcactcgagtgccacccaacaactggccatcggtgttctacgga
tccgcctggaagtggcacgaaggtcgtgagcagtattacctgcaccagttcaccaaggag
cagccggacttgaattttcgtaatcccaaagtggttcaggccatggatgatgtgttgctt
ttctggctcaacaagggcgtagctggtttccgcatcgatgcagtgaatcatttgtttgag
gacgaatctcttaaagatgagccattgagtggcaaaacaggggattcactctcctatgac
tacaccgagcacatctactccagggatctgccagaagtcttggaaatgattcatcactgg
cggcagctgctggatgactttagtgcgaagcaccccgaaagacccacacgcatcatgatg
acggaggcgtacgcaggactcacccagctggcggactactacgaggattccaacggggtt
cggggctcccatctgcccttcaactttcactttatcacggatgtcacaggcgactcggat
gcgcgtgactatgtctacaacgtggagaagtggctgatctacatgccacgcgggcacgcg
gccaactgggtcatgggcaaccacgacaacccacgggtcgcctctcgattcggtccagcc
agtgtggacgccatgaacatgctgctgctcacccttcccggtgtcgccgtcacttataat
ggcgaggagctgggcatggtggactaccgcgaactgagctgggaggacacggtggatcca
ccggccagaaatgttggagaggagctctaccaggaggtctcccgggacccagtccgaaca
ccgttccagtggagtaacgagaccaatgccggtttttccactgccaccaaaacctggctg
cctgtccacccaaactacctcgagctcaacctggaggcccagaaggtggccaacagaagc
cattaccacgtctacaaggatttgcttgagctgcgaaaatcggccattatgcgtgtgggt
cgattcaatattgaaccccttactcgttgggtgtttgccttcaagcggtcctatcccaat
tttgagtcgataattaccgtgataaatgtgagcgacaaggagcagttggtggatctctca
gagtttctcagccatcccaagaaactggtggttgaagtttccggcgtggattcaaaatat
caacctggtcaatccctcgccgcaagtgcattgctcctggccgcccgtgagggtctcgtc
tgtcggctggtctag

DBGET integrated database retrieval system