KEGG   Desulfocapsa sulfexigens: UWK_00931Help
Entry
UWK_00931         CDS       T02473                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
dsf  Desulfocapsa sulfexigens
Pathway
dsf00564  Glycerophospholipid metabolism
dsf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dsf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    UWK_00931
Enzymes [BR:dsf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     UWK_00931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA HI0933_like Pyr_redox_2 NAD_binding_8 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AGF77505
UniProt: M1PCQ2
LinkDB All DBs
Position
complement(1063682..1065259)
Genome map
AA seq 525 aa AA seqDB search
MKRERMLVNIRKQGSKPWDIIVIGGGATGLGTALDAASRGYHTLLLEQDDFSKGTSSRST
KLVHGGVRYLAQGDVSLVLEALHERGLMRHNAPHLVKNQSFIIPNYDWWDGPFYTVGMKV
YDMMAGKLGLGPSQSLSSDEVLRAIPNLKTEGLRGGVIYYDGQFDDSRLAINIAQTCAEH
GGVLLNYMRVSGLTKSGDGIISGVEAVDLESGETYSLLSKSVVNATGVFVDEIMKMDDPD
ALPLVRPSQGVHIILDKQFLKGESAIMIPKTSDGRVLFAVPWHDRVVVGTTDTPLDECSL
EPRALEEEIEFILSTAKKYLTREPQRKDILSIFAGLRPLAAPEEGSDGSSTKEISRSHHL
RVSLSGLVTITGGKWTTYRKMAEDTVDKAALVGGLKQQKCRTEDMPIHGWLANVDYHDPL
YYYGSDADYMRDLVMDHPELGEQLHPGLPYTPIEVIWSARYEMARTVEDILARRQRALFL
DARAAIEMAPAVAKILAKELGRDKEWQELQVREFTELARGYYLLD
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcgaacgcatgcttgtgaatatcaggaaacagggcagcaaaccctgggatatt
attgttatcggcggaggtgctaccggtctgggaacggcccttgatgcagcatcacgtggt
taccacacactccttctggaacaggatgactttagcaaagggacctcaagccgttccacc
aagctggttcacggaggtgtccgttatcttgcccagggcgatgtctctctggtccttgaa
gcccttcacgaacggggacttatgcgtcacaatgctcctcatctggtgaagaaccaatct
tttattattcccaattacgactggtgggatgggcctttttatacggttgggatgaaggtc
tacgatatgatggccgggaaattaggtctcggcccatctcagtcactctcttccgatgag
gtgctgcgtgctattcccaaccttaaaaccgaagggcttcgaggcggtgttatctattat
gatggccagtttgatgattcccgcctggcgatcaatattgctcagacctgtgctgagcac
ggtggagtactgctgaattatatgcgtgtatccgggctcacgaaaagtggtgacggaatt
atttcaggagttgaggccgtggatctggaaagtggtgagacctatagcctgctttcaaaa
agcgtggtgaatgccacgggggtttttgttgatgagatcatgaagatggatgatccggat
gcgctgccacttgtaagacccagtcagggggtacatatcattctggataaacagtttctg
aagggtgaatccgccatcatgatacccaagacatccgatgggcgtgtactttttgccgtg
ccgtggcatgatcgggttgtggttggtaccaccgataccccactcgatgagtgttcactg
gaacctcgtgcattggaagaagaaattgaattcatcctttccacggcaaagaaatatctg
acccgtgaaccgcagcgtaaggatattctttccatctttgcaggtctcaggcctcttgcc
gctcccgaagagggcagtgacggcagtagtaccaaggagatatcccgcagtcatcatttg
cgggtatccctgtctggactggttaccataacaggaggcaagtggaccacctatcgtaaa
atggctgaggatacagtggataaggcggcattggtgggtgggttgaaacagcagaaatgt
aggacggaggatatgcctatccacggatggctggcaaatgtggactatcatgatcctctc
tactattatggttcagatgccgattatatgcgtgaccttgtcatggatcatcccgaactg
ggtgaacagctgcaccctggactgccctatactcccattgaggtcatctggtcggcacgc
tatgaaatggctcgaacggttgaagatatacttgcccgaaggcagagagcgttgttcctt
gacgccagggctgccatcgaaatggctcctgcagtggcaaagatcctggcaaaggagctg
ggaagggataaggagtggcaggaactgcaggtgagagaatttacagaacttgccaggggc
tattatttgcttgactga

DBGET integrated database retrieval system