KEGG   Desulfocapsa sulfexigens: UWK_01365Help
Entry
UWK_01365         CDS       T02473                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
dsf  Desulfocapsa sulfexigens
Pathway
dsf00250  Alanine, aspartate and glutamate metabolism
dsf00410  beta-Alanine metabolism
dsf00430  Taurine and hypotaurine metabolism
dsf00650  Butanoate metabolism
dsf01100  Metabolic pathways
dsf01110  Biosynthesis of secondary metabolites
dsf01120  Microbial metabolism in diverse environments
dsf02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:dsf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    UWK_01365
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    UWK_01365
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    UWK_01365
   00430 Taurine and hypotaurine metabolism
    UWK_01365
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    UWK_01365
Enzymes [BR:dsf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     UWK_01365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AGF77926
UniProt: M1PNC0
LinkDB All DBs
Position
1547607..1549004
Genome map
AA seq 465 aa AA seqDB search
MFVKKSQKELEDHANIQPTYGSRTMREEIPKYELPDEGMPPTAAYNIIHDELALDGNSRL
NLATFVTTWMEPEARQLMTETFDKNMIDKDEYPQTAEIELRCVNILSRLWSSPEGEEAVG
CSTIGSSEAAMLAGMALKRKWKHRMQAAGKPTDKPNFIMGRNVQVCWEKFCNYWEVEPRF
VMAEGNSFNLRPEDAIELCDENTIGVLAIMGSTFDGSYEPVAELNAALDAFYEKSGLDIP
IHVDAASGGFVAPFLQPELMWDFRVPRVKSINVSGHKYGLVYPGVGWAIWRDKKELPEEL
IFHCDYLGGDLPNFALNFSRPGNQVIAQYYNFLRLGLDGYTAIQETCREIALFLSSNIAK
IGPFELISKGDTIPVFAWKLKDHFADTANFSLFDLAERLRYNGWLVPAYRMPENRKDLIV
QRIVVKEGFSRDMAGALLADIQKHVQWFADHPGFNRTMEGKQFSH
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtaaaaaagagccaaaaggaactggaagatcacgccaacatacagccgacttac
ggctcaagaacaatgagggaagagattccaaaatatgagctcccagatgaggggatgccg
ccgaccgctgcctataacattatccatgatgaactggcattagacggaaactcacgactg
aaccttgccacttttgtcacaacctggatggaacctgaagcgcgtcagttgatgacggaa
accttcgacaagaacatgattgataaggatgagtacccgcagactgcagaaattgaattg
cgctgcgtcaacatcctgtcacgcctgtggagctcacccgagggagaagaggctgtgggg
tgttcaacaattggatccagcgaagctgcaatgcttgccggaatggcactgaagagaaaa
tggaagcaccgcatgcaggcagcaggcaaaccgactgacaaaccaaatttcatcatggga
agaaatgttcaggtatgctgggaaaaattctgcaactactgggaagtggaacctcgtttt
gtcatggccgaaggtaatagcttcaatctccgtcccgaggatgccatagaactctgcgat
gaaaacaccatcggtgtactggcgattatggggtccacttttgatggaagctatgaacct
gtggcagagttaaatgctgctctggatgcgttctacgaaaagagcggtctcgatattcct
attcatgttgatgctgccagcggaggtttcgtagctccctttcttcagcctgaactgatg
tgggattttcgggtgccgcgagtgaaatcaataaatgtgtctggccacaaatacggactt
gtctatcccggcgtgggatgggcaatctggcgggacaaaaaggaactgccggaggaatta
attttccactgtgactacctggggggggaccttcccaactttgccctcaacttttcccgg
cccggaaatcaggtgatagcacagtactacaattttttacgccttggccttgatggatac
acagctatccaggaaacctgtcgtgagatcgctctttttctgtcatcgaatattgcgaaa
attggaccttttgaactcataagtaaaggtgataccatccctgtatttgcctggaaactc
aaagatcattttgctgatactgcaaacttcagcctttttgatcttgccgaaaggctccgc
tacaatggctggctggtacccgcctacagaatgccggaaaacaggaaagaccttatcgtt
caacgcattgttgtaaaagaagggttcagtcgtgatatggccggtgccctccttgctgat
atacaaaaacatgtgcaatggtttgccgatcatcccggttttaacaggacaatggaaggc
aaacagttctcacattaa

DBGET integrated database retrieval system