KEGG   Desulfocapsa sulfexigens: UWK_02685Help
Entry
UWK_02685         CDS       T02473                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
dsf  Desulfocapsa sulfexigens
Brite
KEGG Orthology (KO) [BR:dsf00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dsf01001]
    UWK_02685
Enzymes [BR:dsf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     UWK_02685
Protein kinases [BR:dsf01001]
 Serine/threonine kinases: Other
  Bacterial family
   UWK_02685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PEGA APH Pkinase_fungal HHH_2
Motif
Other DBs
NCBI-ProteinID: AGF79221
UniProt: M1PS81
LinkDB All DBs
Position
complement(2992015..2993664)
Genome map
AA seq 549 aa AA seqDB search
MKYGRYEIVSELGRGAMGKVYQAHDPQINRMVALKVLREDRLTTEDYVQRFLKEATAIGR
LSHPGIVTVYDIGQDHGTIYIAMEFLEGQSMDQLVKAGNLSLTDIVDIGIQIAQALHYAH
TRGIIHRDIKPPNIICTPENILKVTDFGIAHIDDPDGQQMTRAGEILGTPVYMAPEQVMG
QTVDGRSDLYSLGVILYELTTGHRPFKGENLTAVFRAITQDDPVPPDQLNPDIPPALSKL
ILKAMARKPEDRFRSGQEMSELLGNCLNVQSQESFSETIIQTAPEKRRSYNGFMIATALL
FCGAALVAYLTMRPPTADDVQQQKNTAAISEQPSHIAVQDEETTPVPPVVLPSKPEEPLA
PIYVPSVPQSSVAPTPVISPDSEEASPVPDAVPEIKKETLQAQRVEESFDDLFTDDRENA
PIFPSTNEPETATKPASLTKVELGIEPDGSLKPSSPITPGTVVASLPPIGKEENSDIQKK
ITTLQINSSPSGASLYIDGNYHGLTPLEIEVTAIKHEVKLELQGHLNWQAQLNLSKGGLV
PLSISLLPE
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacggtaggtatgaaatcgtttccgaactcggtagaggtgccatgggtaaggtt
tatcaggcccatgaccctcagattaaccgtatggtggcactgaaggtacttcgtgaagat
cgacttaccaccgaggactacgtgcagcgttttctcaaagaagctaccgccattggacga
ctctcccatccaggcatagtgacagtctatgatattggccaggatcacggcaccatctac
attgcgatggaatttctggaagggcaatccatggatcaactggtcaaagctggcaattta
agcctgaccgacatcgttgatatcggaatacagatagcccaggccctccattatgcacat
acaagagggatcattcaccgtgatatcaaaccgccaaatattatctgtactcctgaaaat
attcttaaggtaacagactttgggattgcccatatcgatgatccggatggtcagcagatg
actcgagccggtgagatccttggtacccctgtctatatggcccctgagcaggtcatggga
caaaccgttgatggtcgatccgatctttactctttaggtgtcattctctatgagctcacc
acaggtcatcgtccattcaagggtgagaacctcactgccgtctttagagccatcacccag
gatgatcctgttccaccggatcagctcaaccctgatatccccccggctctctcaaagctg
atcctgaaagccatggccagaaaacctgaagatcgattccgcagtggccaggagatgtca
gaacttcttggcaactgtcttaatgttcaatctcaggaatcttttagcgaaacaattatt
cagacagcacctgaaaaacggcgttcttataacggctttatgatagcgaccgctctcctc
ttctgcggagctgccctggtcgcttatctcaccatgaggccacctacagcagatgatgtc
cagcaacaaaaaaatacggccgcaatatcggaacagccctcgcacattgctgtgcaagat
gaggagaccacacccgttcctccggtagtactaccaagtaaacctgaagaaccacttgcc
ccgatttatgtaccttccgtcccccaatcatctgtggcacccacacccgttatatcacct
gattctgaagaagcctctcccgtacccgatgcagtaccagaaataaaaaaagaaacgttg
caggcacaacgggtcgaagagtcgtttgacgatctttttacagatgacagagagaatgca
ccaatttttccctccacaaacgagcctgaaactgccacgaaaccagcttccttgacaaaa
gttgaactgggaattgagccagatggcagcttaaaaccttcgtcaccaattacgcctggt
acagtagtagcctcactaccaccaataggaaaagaagagaattccgatatccagaaaaaa
ataacaaccttacaaataaacagcagtccatctggagcaagcctctacatagacgggaac
tatcatggattaacccccctggagattgaggttacagcaataaaacatgaggtgaaactt
gaactgcagggacatcttaactggcaggcccagctgaacctcagcaagggaggactggtt
ccactctccatctctcttttaccagaatag

DBGET integrated database retrieval system