KEGG   Desulfocapsa sulfexigens: UWK_02700
Entry
UWK_02700         CDS       T02473                                 

Definition
(GenBank) type VI secretion protein, VC_A0111 family
  KO
K11895  type VI secretion system protein ImpH
Organism
dsf  Desulfocapsa sulfexigens
Brite
KEGG Orthology (KO) [BR:dsf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dsf02044]
    UWK_02700
Secretion system [BR:dsf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   UWK_02700
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: AGF79236
UniProt: M1PS96
LinkDB
Position
complement(3011180..3012208)
AA seq 342 aa
MAGTDRGTSPDLKLDVKLSLLKEGENFSFFQVIRLLRLYLDSPSSESKAAPYQHNQIRIV
PHLSLGFPASDIESIEEHCDQNDKSTFKIKTNFLSLYGSSSPLPTFYSEELLDEASEDTS
ASRDFLDIIHQRLYLLFFQSWLKYRQFQQISEEEENSHLERLFCLLGLGEPEFRKNIQNP
KDLLRYAGLFSQAPRSALGLKTLLSDALNLPVDILSCLERKAKIPEDQRIQLGASVVALG
CDSFLGEEIGDRMGRFRIEIGPLDEPEYRAFLPGSALYNKVVMLTDLFVSDPLDYDIKVT
MAGRQAKTVCLGGEQWSGLGLDSWLFSGEEIGEKSNLFYPQR
NT seq 1029 nt   +upstreamnt  +downstreamnt
atggccggcacggataggggaacgtcccctgatttaaagctagatgtcaagttgtcctta
ctgaaagaaggagagaacttttctttttttcaggtcattagactgctccgcctttatctt
gattctccgtcctctgagagtaaagcagccccctaccaacataatcaaatccggattgtc
ccccatttatcccttggttttcctgcaagtgatattgaatcgatcgaagaacattgtgat
cagaatgacaagagtacgttcaaaataaaaactaattttttaagtttatacgggtcctca
tctcccctgccaaccttttacagtgaggagctgttggatgaggcctcagaagacacatct
gccagccgtgatttcctcgatatcattcaccaaagactctatctcctctttttccaaagc
tggttgaagtatcggcagtttcaacaaatcagtgaggaagaggagaattcccatctggag
cgtcttttttgcttactgggtttgggagaaccggaattccgaaaaaatattcaaaacccc
aaggatttacttcgatatgccggattgttcagtcaggccccaagatcagccttaggcctg
aaaaccctgctttccgacgctttaaatcttcccgttgacattctctcctgcctggaacga
aaagcgaaaattcctgaagatcagagaattcagcttggtgcatctgttgtcgcccttggc
tgtgacagctttcttggagaagagattggagatcgaatgggtcggtttcgtatagaaata
ggaccacttgatgaaccagaatatagagcatttctccccggcagcgccttgtataataag
gttgtcatgctgacagacctcttcgtcagtgatcctcttgattacgacattaaggtaacc
atggcgggtcgacaggccaaaacagtctgtcttggaggcgaacaatggtcgggccttggt
cttgacagctggctgttttctggagaagagatcggagaaaaaagtaacctgttttatcct
caaagataa

DBGET integrated database retrieval system