KEGG   Dinoroseobacter shibae: Dshi_0630Help
Entry
Dshi_0630         CDS       T00612                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
dsh  Dinoroseobacter shibae
Pathway
dsh00564  Glycerophospholipid metabolism
dsh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dsh00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dshi_0630 (glpD)
Enzymes [BR:dsh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Dshi_0630 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox_2 FAD_binding_3 NAD_binding_8 Mqo FAD_oxidored FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ABV92376
RoseoBase: Dshi_0630
UniProt: A8LQ90
LinkDB All DBs
Position
complement(627302..628897)
Genome map
AA seq 531 aa AA seqDB search
MPETDAKLHDLFIIGGGINGCGIARDAAGRGLSVALAEMNDLASGTSSGSTKLFHGGLRY
LEYFEFRLVREALIEREVLLRAMPHISWPKRFVLPYHPDMRFEGQTPTSKLLGIFMPWMK
GRRPAWLIRLGLFLYDNLGGRKILPGTETLSLQGTPEGAPLEPRFEKAFEYSDCWVEDSR
LVVLNARDAEARGAEIHMRTKVVATERHADHWRIETQEADTGTRRSFRAKMLVNAGGPWV
AELLTGTLRLNVPDTVRLVRGSHIVVPKLYDHDKCYFFQGTDGRIIFAIPYETDFTLIGT
TDAEHPDPSQKPECTPEERDYLLAFANQYFKQDITAEDVVWTYSGVRPLYDDGASSVTAA
TRDYTLKTDAAAGAPVLNVFGGKITTYRRLAESALAQIGAQLPVGAGPWTAGVALPGGNF
PVDGVEELIAQLRAAYPFLSARWATRLIRAYGRDAWEVLGDAKTEADLGEGFGATLTARE
VRWLMTREYARQAEDVVWRRSKLGLRMSAEEIVTLDRWMQAARRTLPQSAA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgccggaaacagacgcgaaattgcacgacctcttcatcatcggggggggcatcaatggt
tgcgggatcgcgcgcgatgccgccgggcgcgggctctcggtggcgctggccgagatgaac
gatctggcctcgggcacttcgtcggggtccaccaagctcttccatggcgggctgcgatac
ctggagtatttcgaattccggctggtgcgcgaggccctgatcgagcgggaggtgctgctg
cgcgcgatgccccatatcagctggcccaagcggttcgtgctgccctatcacccggacatg
cgcttcgaagggcagaccccgacctcgaaactgctgggcattttcatgccctggatgaag
gggcggcggcccgcctggctgatccggctggggctgttcctctatgacaacctgggcgga
cggaagatcctgccggggaccgagaccctgtcgctgcagggcacgcccgaaggcgcaccg
ttggagccgcggttcgagaaggcgttcgagtattccgactgctgggtggaggattcgcgt
ctggtggtcctgaacgcgcgcgatgcggaggcgcgcggggcggagattcacatgcgcacc
aaggtcgtcgcgaccgagcggcatgccgatcactggcggatcgagacccaagaggccgac
accggcacgcggcgcagtttccgggcgaagatgctggtgaacgcaggcgggccctgggtc
gccgaactgctgaccgggaccctgcggctgaacgtgccggacacggtgcggctggtgcgg
ggcagtcacatcgtggtgcccaagctctatgaccacgacaagtgctacttcttccagggg
accgatgggcggatcatcttcgcgatcccctacgagacggatttcaccctgatcggcacc
accgatgcggagcatccggacccctcgcagaagcccgaatgcacgccggaggagcgcgac
tacctgctggccttcgcgaaccagtatttcaagcaggacatcacggccgaggacgtggtc
tggacctattccggggtgcggccgctttatgatgacggcgcgagcagcgtgacggcggcg
acgcgggattacacgctcaagaccgatgccgcggccggggcgccggtgctgaacgtgttc
ggcggcaagatcaccacctatcggcggctggcggaaagcgcgttggcgcagatcggcgcg
cagctgcccgtcggcgcggggccgtggaccgccggcgtggcactgcccgggggcaatttc
ccggtggacggggtcgaggagctgatcgcgcagctgcgcgcggcctatccgttcctgagc
gcacggtgggcgacgcggctgatccgcgcctatgggcgcgacgcgtgggaggtgctgggc
gacgcgaagaccgaagccgatctgggcgaggggttcggcgcgaccctgaccgcgcgggag
gtgcgctggcttatgacgcgcgaatatgcgcggcaggccgaggacgtggtctggcggcgc
agcaagctgggcctgcggatgagcgccgaagagatcgtaacgctggaccgctggatgcag
gcagcgcgccgcaccctgccgcaatcggccgcataa

DBGET integrated database retrieval system