KEGG   Dinoroseobacter shibae: Dshi_1207Help
Entry
Dshi_1207         CDS       T00612                                 

Gene name
gatB
Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
dsh  Dinoroseobacter shibae
Pathway
dsh00970  Aminoacyl-tRNA biosynthesis
dsh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsh00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Dshi_1207 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dsh03029]
    Dshi_1207 (gatB)
Enzymes [BR:dsh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Dshi_1207 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Dshi_1207 (gatB)
Mitochondrial biogenesis [BR:dsh03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Dshi_1207 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey Aconitase_B_N YqeY
Motif
Other DBs
NCBI-ProteinID: ABV92949
RoseoBase: Dshi_1207
UniProt: A8LI95
LinkDB All DBs
Position
complement(1245310..1246827)
Genome map
AA seq 505 aa AA seqDB search
MLDLTYETPKPKVIAGAREDWELVIGLEVHAQVATNAKLFSGASTLFGAEPNSNVAFVDA
GMPGMLPVINEECVAQAVRTGLGLKAAINLTSAFDRKNYFYPDLPQGYQISQLYHPIVGE
GEVLVELGDGTARVVRIERIHLEQDAGKSIHDMDPHMSFVDLNRTGVALMEIVSRPDIRG
PEEAAAYVSKLRQIMRYLGTCDGNMQNGNLRADVNVSVCRPGDYEKYQASQDFSHLGTRC
EIKNMNSLRFIQQAIEYEARRQIAIIEDGGSVTQETRLYDPDKGETRSMRSKEEAHDYRY
FPDPDLLPLEIEQAWVDDIAAALPELPDAKKARFITEFGLSDYDASVLTADTTNAAYFEA
VAGEAGDGKLAANWVINELFGRLKKEDHDITESPVSPAQLAGIIKLIKADAISGKIAKDL
FEIVYTEGGDPAEIVEARGMKQVTDTGAIEAAVDEIIAANPAQVAKAQENPKLAGWFVGQ
VMKATGGKANPKAVNQIVAAKLAQQ
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacctcacatacgagaccccgaaacccaaggtcatcgcaggcgcgcgggaggat
tgggaactggtgatcgggcttgaggtgcacgcccaggtcgccaccaatgccaagctgttc
tccggcgcctcgaccctgttcggggcggagccgaattccaacgtcgcgttcgtggatgcg
ggcatgccggggatgctgccggtgatcaacgaggaatgcgtcgcgcaagcggtccgcacg
gggctgggcctgaaggcggcgatcaatctgacctcggccttcgaccgcaagaactatttc
tatcccgatctgccccagggctaccagatcagccagctttaccaccccatcgtgggcgag
ggcgaggtgctggtcgagctgggcgatggtacggcgcgcgtggtgcggatcgagcgcatt
cacctggaacaggacgcgggcaagtcgatccacgacatggacccgcatatgtccttcgtg
gacctgaaccgcacgggcgtggccctgatggagatcgtctcccgccccgatatccgcggg
cccgaagaggcggccgcctatgtcagcaagctgcgccagatcatgcgctatctcggcacc
tgcgacggcaacatgcaaaacggcaacctgcgcgcggatgtgaacgtgtcggtctgccgc
cccggggattacgagaaataccaggcgagccaggatttctcacatctcggcacgcgctgc
gagatcaagaacatgaactccctccggttcatccagcaagccatcgaatacgaggcgcgc
cgccagatcgcgatcatcgaggacggcggcagcgtgacccaggaaacccggctctacgat
ccggacaagggggagacgcggtccatgcgctccaaggaagaagcgcatgattaccgctac
ttccccgaccccgacctgctgccgctggagatcgagcaggcctgggtcgacgatatcgcc
gccgccctgcccgagctgcccgacgccaagaaggcgcggttcatcaccgagttcggcctg
tcggattacgatgccagcgtcctgaccgccgacaccactaatgccgcctatttcgaggcc
gtggcgggggaggcaggcgatggcaagctcgcggcgaactgggtgatcaacgagctgttc
gggcggctgaagaaggaagaccacgacatcaccgaaagcccggtctcgcccgcgcaactc
gccgggatcatcaagctgatcaaggccgacgcgatttcgggcaagatcgccaaggacctg
ttcgagatcgtctataccgagggcggcgatccggccgagatcgtcgaggcgcgcgggatg
aagcaggtcaccgataccggtgcgatcgaggccgcggtggacgagatcatcgccgccaat
cccgcccaggtcgccaaggcgcaggaaaatcccaagctcgccggttggttcgtgggccag
gtgatgaaggccacgggcggcaaggccaaccccaaggccgtgaaccagatcgtcgccgcc
aagctggcgcagcagtaa

DBGET integrated database retrieval system