Dinoroseobacter shibae: Dshi_1617 Help Entry Dshi_1617         CDS       T00612                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dsh  Dinoroseobacter shibae Pathway dsh01100   Metabolic pathways dsh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dsh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Dshi_1617   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Dshi_1617 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ABV93359 RoseoBase:  Dshi_1617 UniProt:  A8LKZ5 LinkDB All DBs Position complement(1681897..1682166) Genome browser AA seq 89 aa AA seqDB search MSDTVREKVIAIIAEQAVLEPADIRPEATMEDLGIDSLGLVEAIFAIEETFDVSVPFNAN EPEKSDFDISNVAAITRAVETLVAEQTDA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtccgataccgtgcgcgaaaaggtcatcgcgatcatcgctgagcaggcagttctggag cctgcggatattcggcccgaggccacgatggaggatctcggcatcgacagtctcgggctt gtcgaagcgatcttcgccatcgaggagactttcgatgtgtccgtgccgttcaacgcaaat gaacccgagaaaagcgatttcgacatctccaacgtcgccgcgataacgcgggcggtggaa acccttgtggccgagcagacggacgcctga

DBGET integrated database retrieval system