KEGG   Dinoroseobacter shibae: Dshi_2320Help
Entry
Dshi_2320         CDS       T00612                                 

Gene name
gcvT1
Definition
(GenBank) aminomethyltransferase
  KO
K17486  dimethylsulfoniopropionate demethylase [EC:2.1.1.269]
Organism
dsh  Dinoroseobacter shibae
Pathway
dsh00920  Sulfur metabolism
dsh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsh00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Dshi_2320 (gcvT1)
Enzymes [BR:dsh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.269  dimethylsulfoniopropionate demethylase
     Dshi_2320 (gcvT1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C
Motif
Other DBs
NCBI-ProteinID: ABV94056
RoseoBase: Dshi_2320
UniProt: A8LRM5
LinkDB All DBs
Position
complement(2452182..2453288)
Genome map
AA seq 368 aa AA seqDB search
MTPLLSLARRLRRTPFSEGVEAAGVRAYTVYNHMLLPTVFESVEEDYHHLKQKVQVWDVS
CERQVELRGPDAGKLMQLLTPRDLRGMLPGQCLYVPMVDETGGMLNDPVALKLSEDRFWI
SIADSDLLLWVKALANARQLEVLVEEPDVSPLAVQGPLADDLVERVFGADAVSLRFFRFG
FFQFQGHDLVVARSGYSRQGGFEIYVEGSDLGMPLWHALFEAGADLDVRAGCPNGIERVE
GGLLSYGNDMTRWNTPFECGLERFCNVQTAIGCLGRDALLRVSMDGPNRQIRPIEIEGER
VPVCDRAWRLLAGDEHVGQVTSAAWSPDFDTNVAIGMVRMTHWDPDTELMVETQEGLRPA
RVQENFWI
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgacgcctttgctctcccttgcccgccggctgaggcgcacgccgttctccgaaggggtg
gaggccgccggggtgcgcgcctacacggtctacaaccacatgctgctgccgactgtgttc
gagtccgtcgaggaggattaccaccatctcaagcagaaggtgcaggtctgggatgtgtcc
tgcgaacggcaggtggagttgcgcggcccggatgcgggcaagttgatgcagcttctgacc
ccgcgggacctgcgcgggatgttgccggggcagtgtctgtatgtgccgatggtggacgag
accgggggcatgctgaacgatcccgtggcgctgaagctgtccgaggaccggttctggatc
tcgatcgccgacagtgatctgctcctgtgggtgaaggcgctggccaatgcccgccagctc
gaagtgctggtcgaagagcccgatgtctcgcccctggcggtccagggcccgctcgccgat
gatttggtcgagcgggtgttcggcgcggatgcggtcagcctgcggtttttccgcttcggg
ttcttccagttccagggtcatgacctggtcgttgcgcgctcgggctattcccggcagggc
ggcttcgagatctacgtggaaggtagcgatctgggcatgccgctctggcatgccctgttc
gaggcgggtgctgatctcgacgtgcgcgcgggctgccccaacgggatcgagcgggttgag
ggcgggctattgagctacggcaacgacatgacccgctggaacacccccttcgaatgcggg
ctggagcggttctgcaacgtgcagacggccattggctgcctggggcgcgatgcgctcctg
cgggtgtccatggacggcccgaaccgccagatccgccccatcgagatcgaaggcgagcgg
gtgccggtctgcgaccgggcctggcgccttctggccggggacgagcatgtggggcaggtg
acctccgccgcgtggtcgccggacttcgacacgaatgttgccatcggcatggtgcggatg
acccattgggacccggacaccgaattgatggtcgagacgcaggaggggctgcgccccgcc
cgcgtgcaggaaaatttctggatctga

DBGET integrated database retrieval system