KEGG   Dinoroseobacter shibae: Dshi_2589Help
Entry
Dshi_2589         CDS       T00612                                 

Definition
(GenBank) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
dsh  Dinoroseobacter shibae
Pathway
dsh03030  DNA replication
dsh03410  Base excision repair
dsh03420  Nucleotide excision repair
dsh03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:dsh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Dshi_2589
   03410 Base excision repair
    Dshi_2589
   03420 Nucleotide excision repair
    Dshi_2589
   03430 Mismatch repair
    Dshi_2589
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dsh03032]
    Dshi_2589
   03400 DNA repair and recombination proteins [BR:dsh03400]
    Dshi_2589
Enzymes [BR:dsh01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Dshi_2589
    6.5.1.6  DNA ligase (ATP or NAD+)
     Dshi_2589
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Dshi_2589
DNA replication proteins [BR:dsh03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Dshi_2589
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Dshi_2589
DNA repair and recombination proteins [BR:dsh03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Dshi_2589
   NER (nucleotide excision repair)
    Other NER factors
     Dshi_2589
   MMR (mismatch exicision repair)
    Other MMR factors
     Dshi_2589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ABV94322
RoseoBase: Dshi_2589
UniProt: A8LHY8
LinkDB All DBs
Position
2754445..2756049
Genome map
AA seq 534 aa AA seqDB search
MKDFAALFTSLDQTTKITPKVAALAAYFRTAPEEDRLWTIALLSGRRPKRTVTTTRLREW
AAERAGIPLWLFEEAYPVVGDLAETIALVLPPPTRTSTRSLTDWITTIRGLAARDEPDRR
AEILAAWDSLPETERFVFNKLITGGFRMGVSAKLMTRALSQATDIPEPELAHRLMGDWTP
ETTSFQSLVLTRDPAADLSKPYPFYLAYGLEDPPDTLGPPADWQAEHKWDGIRGQLILRG
GQHFVWSRGEELMTDRFPELAALRDFLPDGTVLDGELLAWDYNGAGDAPLPFNALQKRIG
RKTVPKKLLSEAPVILRAYDLLEDGGTDLRDRPLSERRARLEALAAALPDTLPLRLSPTL
TFDSWDALAQIRAKSREMGAEGIMLKRRASPYLAGRKKGDWWKWKVDPLTIDAVMIYAQA
GHGRRANLFTDYTFAVWDGNELVPFTKAYSGLTDAEFRQITAWVRKNTLERFGPVRRVTP
EHVFEIAFEGIQASPRHKSGVALRFPRMLRWRKDKPLQEANTLEDLKGMLEVYG
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggacttcgccgcgctcttcacctccctcgaccagaccacgaagatcacgcccaag
gtcgccgccctcgccgcctatttccgcaccgcccccgaggaggaccgcctctggaccatc
gcgctcctgtccggccgccgccccaagcgcaccgtgaccaccacccgcctgcgcgaatgg
gcggccgagcgcgcgggcatccccctgtggctcttcgaagaggcctacccggtcgtcggc
gatctggccgaaaccatcgccctcgtcctgccgccccccacccgcaccagcacccgctcg
ctcaccgactggatcaccaccatccgcggcctcgccgcccgcgacgaacccgaccgccgc
gccgaaatcctcgcggcctgggacagcctgcccgagaccgaacgcttcgtgttcaacaag
ctcatcaccggcggcttccgcatgggcgtgtcggccaagctgatgacgcgcgccctgtcg
caggccaccgacattcccgaacccgaactggcccaccgcctcatgggcgactggacgccg
gagaccaccagcttccaatccctcgtgctcacccgcgacccggcggcggacctgtccaaa
ccctatccgttctacctcgcctacgggctggaggatccgcccgacaccctcggccccccc
gccgactggcaggcggagcacaaatgggacggcatccgcggccagctcatcctgcgcggc
ggccagcacttcgtctggtcccggggcgaagagctgatgaccgaccgcttccccgagctt
gccgccctgcgcgacttcctccccgacggcaccgtgctcgacggcgaactgctcgcctgg
gattacaacggcgcgggcgacgcccccctgccattcaacgccctgcaaaaacgcatcggc
cgcaagaccgtgcccaaaaaactcctgtccgaggccccggtgatcctgcgcgcctacgac
ctgctggaggacggcggcaccgacctgcgcgaccgccccctgtcggagcgccgcgcgcgg
ctggaggccctggccgccgccctgcccgacacgctgcccctgcggctctccccgaccctg
accttcgacagctgggacgcgctggcccaaatccgcgcaaaatcgcgcgagatgggcgcc
gaagggatcatgctcaaacgccgcgcctccccctacctcgcgggccgcaagaagggcgac
tggtggaaatggaaggtcgatcccctgaccatcgacgcggtgatgatctacgcccaggcg
ggccacggacgccgcgcgaaccttttcaccgactacactttcgcggtctgggacggaaac
gagcttgtccccttcaccaaggcctattcgggcctcaccgacgccgagttccgccagatc
accgcctgggtccgcaagaacaccctggaacgcttcggccccgtgcgccgcgtaaccccc
gaacacgtcttcgagatcgccttcgaggggatacaagccagcccccgccacaaatccggc
gtcgccctgcggttcccgaggatgctgcgctggcgcaaggacaaaccgctgcaagaggcg
aacacgctggaggatttgaaagggatgttggaggtgtatgggtag

DBGET integrated database retrieval system