KEGG   Dinoroseobacter shibae: Dshi_2596Help
Entry
Dshi_2596         CDS       T00612                                 

Definition
(GenBank) ABC transporter
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
dsh  Dinoroseobacter shibae
Pathway
dsh02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:dsh00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Dshi_2596
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dsh02000]
    Dshi_2596
Transporters [BR:dsh02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    Dshi_2596
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 MeaB MobB AAA_30 AAA_29 AAA_16 AAA_22 NACHT MMR_HSR1 AAA_33 AAA_18 PRK TrwB_AAD_bind AAA_5 NTPase_1 APS_kinase RsgA_GTPase Zeta_toxin RNA_helicase CbiA ATP_bind_1 DUF815
Motif
Other DBs
NCBI-ProteinID: ABV94329
RoseoBase: Dshi_2596
UniProt: A8LHZ5
LinkDB All DBs
Position
2761173..2761856
Genome map
AA seq 227 aa AA seqDB search
MTIEVQGLSAERSGRTILHPTNVDFKPGERVGLVGSSGSGKSTLGHELVDALRAQGASVA
HVPQSPDEALDPLRSMAFHWREAERALGLAPDDARREVLFKALRIEGGDLRKRPWCWSRG
MQQRFVIAMALIGTPDLLVMDEPTSALDPVVAAGTMDLLEDYLKNRQTALLLITHDLGLA
ARRVARLMVMDAGRIVEDAPTEAFLASPKTRTAKALCAHRNWLELPC
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgacgattgaagtccaaggcctgagcgccgaacgctcaggtcgcaccatccttcatccc
acgaatgtggacttcaagcccggcgaacgcgtcgggcttgtaggtagctcgggatccggc
aagtcgacccttgggcatgaactggtggacgcgttgcgcgcgcaaggagccagcgttgcc
catgtgccgcaaagcccggatgaagcgctcgacccacttcggtcgatggcgttccattgg
cgggaagcggagcgggccttgggtctagccccggacgacgcgcgccgcgaggtgctgttc
aaagcccttcggatcgaagggggcgaccttcgcaaacgcccctggtgctggagccgtggg
atgcagcagcggtttgtgatcgccatggctttgatcggcacacctgacctgttggttatg
gacgaacctacctccgcgctggaccccgtggtggcagcgggtaccatggatttgcttgag
gactatctcaaaaatcggcaaacggcgctcttgctcatcacccacgatcttgggcttgcg
gcacgccgggtcgcgcgcttgatggtgatggatgccgggcgcattgtagaggatgcaccg
accgaagcatttctcgcatcgccgaaaacacgaaccgccaaggccctttgcgcccaccgg
aattggctggagctgccatgctga

DBGET integrated database retrieval system