KEGG   Dinoroseobacter shibae: Dshi_2641Help
Entry
Dshi_2641         CDS       T00612                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
dsh  Dinoroseobacter shibae
Pathway
dsh00240  Pyrimidine metabolism
dsh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Dshi_2641 (tdk)
Enzymes [BR:dsh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Dshi_2641 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30
Motif
Other DBs
NCBI-ProteinID: ABV94374
RoseoBase: Dshi_2641
UniProt: A8LI40
LinkDB All DBs
Position
2798852..2799451
Genome map
AA seq 199 aa AA seqDB search
MRAMAKLYFHYSTMNAGKSTALLQASHNYIERGMQTHLMTARLDHRAGEGRIGSRIGLSA
PADTFGPETDLFDALALRLKGGPCACVFVDEAQFLTEDQVWQLARAVDDLNLPVMCYGLR
VDFRGKLFPGSAALLALADEMREVRTICHCGRKATMVVRRDAEGRTVTDGAQVQVGGNET
YLSLCRRHWREATGDRPRG
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcgccatggccaagctttacttccactactccaccatgaacgcgggcaaatcgacc
gcgctgctgcaagcctcgcacaattatatcgagcgggggatgcagacccacctgatgacc
gcgcggctcgaccaccgggcgggcgagggccggatcggcagccggatcgggctgagcgcg
cctgccgacaccttcgggcccgagaccgacctcttcgacgcgctggccctgcggctcaag
ggcgggccctgcgcctgcgtcttcgtggacgaggcgcagttcctgaccgaggaccaggtc
tggcaactcgcccgagcggtggacgatctgaacctgccggtgatgtgctacgggctgcgg
gtcgattttcgcggcaagctgtttcccggctcggcggcgctgctggcgctggcggacgag
atgcgcgaggtgcgcacgatctgccattgcgggcgcaaggccacgatggtggtgcgccgc
gacgccgaggggcgcacggtgaccgacggtgcccaggtgcaggtgggcggcaacgagacc
tacctgtcgctctgccgccgccactggcgggaagccacgggcgaccgcccgaggggttag

DBGET integrated database retrieval system