KEGG   Drosophila simulans: Dsimw501_GD10563Help
Entry
Dsimw501_GD10563  CDS       T01065                                 

Gene name
Dsim_GD10563
Definition
(RefSeq) uncharacterized protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
dsi  Drosophila simulans
Pathway
dsi00052  Galactose metabolism
dsi00500  Starch and sucrose metabolism
dsi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Dsimw501_GD10563 (Dsim_GD10563)
   00500 Starch and sucrose metabolism
    Dsimw501_GD10563 (Dsim_GD10563)
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     Dsimw501_GD10563 (Dsim_GD10563)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 6733536
NCBI-ProteinID: XP_002080591
FlyBase: FBgn0182334
UniProt: A0A0J9R8A2
LinkDB All DBs
Position
2R
AA seq 567 aa AA seqDB search
MPKWAHLGLAALLLISTTQEGAADIDWWENASLYQIYPRSFQDSDGDGIGDLKGITSRLG
YLKEIGITATWLSPIFTSPMSDFGYDISNFYDIDPIFGTLDDFDALIVEAKSLGVKIILD
FVPNHSSDENVWFEKSVNREDGYDDFYVWDDGKLNEETGARDPPSNWVSVFSGPMWTWNE
KRQQYFLHQFQVKQPDLNFTNQMVREHMLDVLKFWLDRGVDGFRIDAVPHIYEHRNADGS
YPDEPVSGWGSDPNAYDYHDHIYTKDQPATVDLMYEWREFLDTYRAQNGGDSRVLLAEAY
SSVETLSAYFGNSTHQGTQLPMNFQLMYLSGYSTAKDVVGSIDYWMNTMWKEHQTANWVV
GNHDTNRVADRMGAHKVDLLNVIVNALPGASVTYYGEEIGMSNVDVECTGDSCEDRDGER
TPMQWTAGKNADFSDGESTWLPLSPEYQRYNVQTERGVSRSSLNIFKGLQALKSSSAFLA
FKDDGGFSYEAVTEQVLQIIRTNKISEEYRILVNMGNGMEILDGLAPKTYEYVLATAYST
HYPGQKADLSQRIILMPYEAVVLRWLA
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagtgggcacatctcgggctagcggctctccttctaatttccaccacccaggag
ggtgctgcggatatcgattggtgggagaacgcctcgctgtaccagatatatccgcgctcc
ttccaggacagcgacggcgatggcatcggggacctgaaaggcattacttcgagattgggc
tatctcaaggaaataggcatcacggccacctggctgtcgcccatttttacctcgcccatg
tcggatttcggctacgacatctccaacttctacgacatcgatccgattttcggcactctc
gacgatttcgatgcccttatagtggaggccaagtcgctgggcgttaagatcatcctcgac
tttgtacccaaccactcgagcgacgagaacgtgtggtttgaaaagtccgtgaatcgcgag
gacggctacgacgacttttacgtgtgggacgatggaaagctgaatgaggaaactggtgca
agagatcctccgtctaactgggtcagtgtgttcagtggacccatgtggacgtggaacgag
aagcgccagcagtactttctgcaccagtttcaggtgaagcagccggatctaaactttacc
aatcaaatggtcagggagcacatgctggatgtcttgaagttttggctggaccgcggtgtt
gatggattccgtatcgatgcagttccacacatttacgagcaccgcaatgcagacggatcc
tatccggatgaaccggttagcggttggggcagtgaccccaacgcgtacgactaccacgat
cacatctataccaaggaccagccggccacggtggatctcatgtacgagtggcgtgagttt
ttggacacctatcgggcacagaatggaggtgattcacgggttctgctggccgaggcctat
tcttccgtggagacactgagtgcttacttcggaaacagcacccatcagggtacccagctg
cctatgaacttccagttgatgtatctcagtggatattccaccgccaaggatgttgtggga
tccatcgactactggatgaataccatgtggaaggagcaccagacggccaattgggtcgtt
ggcaatcacgacaccaaccgagtggccgatcgtatgggagctcacaaagtggatctgcta
aatgtgattgtaaacgccctgccaggtgcttcggtcacctactacggcgaggaaatcggc
atgtccaacgtggacgtggagtgcaccggcgactcttgcgaggatcgcgatggagagcgt
acgccaatgcagtggacggctggaaagaatgccgacttctctgatggggagtccacctgg
ctgcctctaagccccgaatatcaaaggtacaatgtgcagactgaacgcggtgtttccaga
tcctccctgaacatctttaagggtcttcaagcacttaagagcagttccgcctttcttgcg
ttcaaagacgatggaggtttctcctacgaggcggtgacggaacaggttctacagatcatt
cgcacaaacaagatcagcgaggaatatcgaatcctggtcaacatgggcaacggtatggaa
atcctcgatgggctggcccccaaaacctacgagtatgtgctggccactgcctactccaca
cactatccggggcaaaaagcggatctgtcacagagaatcattctcatgccctacgaagca
gtcgttctacgctggttggcttaa

DBGET integrated database retrieval system