KEGG   Drosophila simulans: Dsimw501_GD10565Help
Entry
Dsimw501_GD10565  CDS       T01065                                 

Gene name
Dsim_GD10565
Definition
(RefSeq) uncharacterized protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
dsi  Drosophila simulans
Pathway
dsi00052  Galactose metabolism
dsi00500  Starch and sucrose metabolism
dsi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Dsimw501_GD10565 (Dsim_GD10565)
   00500 Starch and sucrose metabolism
    Dsimw501_GD10565 (Dsim_GD10565)
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     Dsimw501_GD10565 (Dsim_GD10565)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase DUF4635
Motif
Other DBs
NCBI-GeneID: 6733540
NCBI-ProteinID: XP_016026499
FlyBase: FBgn0182336
UniProt: A0A0J9R862
LinkDB All DBs
Position
2R
AA seq 579 aa AA seqDB search
MTTWTSLFLLLGLGLLAVDAAAPWWKTASFYQIYPRSFKDSDGDGIGDLNGVTEKLEYLK
EIGVTATWLSPFLKSPMADFGYDISDFKAVDPLFGTMEDFENMVSRAKQLGVKIILDFVP
NHSSDECDWFLRSAAGEEEYKDYYIWHPGFLDEDGNRRPPTNWVSVFRGSAWEWHEGRQE
YYLHQFHKKQPDFNFRNPVVREEMNNVLRFWLEKGVDGFRVDAIYHAFEIEADENGNYPD
EPRNDWTNDPDEYGYTHKIYTVDQPETPHLVYEWRQILEQFQADNGGDERILMVETWSPI
EIVMHYYGNETADGAQIPFNFQLISNLHYDSDAYHYEYLINNWLNLMPEGKSANWVIGNH
DKNRVGSRFGADRVDLFNILLLTLPGCSITYQGEELGMLDGYVSWKDTVDPQACNGYEEN
YMDNSRDPARTPMHWSDETMAGFTTGKSTWLPVSTDYRQRNVKTERGVSLSHLNVFKRLQ
QLRQEPSIEEGSAEVKAVSNYVLAVKRHLSGDFVYISLFNIFDSIENVNLSNVFGSLPAK
FQYALVTEKSIKKVGDQVSAGSVTLMPHEAIVLRSTTTA
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgaccacttggactagcttgttcctgcttttgggccttggccttctggccgtcgatgcc
gcggcaccctggtggaagaccgcttccttttaccagatctacccgcgatccttcaaagac
agtgacggagatggaatcggagacttaaacggagtgactgagaagctagagtaccttaag
gagatcggcgtgaccgccacctggctgtctccttttctaaaatccccgatggccgacttc
ggctacgatatttccgactttaaggcggtcgatcctcttttcggaacgatggaggacttc
gagaatatggtctcccgcgccaagcagctgggtgtcaagattattctcgacttcgtgccc
aatcattccagtgatgagtgcgactggttccttcgttcggctgccggcgaggaggagtac
aaggactactacatctggcacccgggattcctcgatgaggacggaaaccgtcgcccgccc
accaactgggtgagcgtcttccgaggcagcgcatgggagtggcacgagggtcgccaggag
tactacctgcatcaattccacaagaagcagccggacttcaacttccgtaatcccgtggtg
cgcgaggagatgaacaacgtgctgcgattctggctggaaaaaggcgttgacggtttccgc
gtggatgccatctaccacgcctttgagattgaggccgacgagaatggaaactatccggat
gagccccgcaacgattggaccaacgatccagatgagtacggatacacccacaagatctac
actgtggatcagccagagactccgcacttggtatacgaatggcgccaaattcttgagcag
ttccaggctgacaatggcggtgatgagcgcattttgatggtggagacatggtcccccatt
gaaatcgtaatgcattactatggcaacgaaaccgccgatggagcccagataccgtttaac
ttccagctgataagcaatctgcactacgattccgatgcctatcactacgagtacttgatt
aacaactggcttaatctgatgcccgagggcaagagcgccaactgggtgatcggtaaccat
gacaagaaccgtgtgggctctcgattcggagccgatcgagttgacctcttcaacatcctg
ctgctcactctgcccggctgcagcatcacgtaccagggtgaggagctgggcatgctcgac
ggatatgtgtcctggaaggacaccgtggatccgcaagcctgcaacggctacgaggaaaac
tacatggataattcccgtgaccctgcccgcactccgatgcactggtcggatgagacgatg
gctggattcaccactggcaagagcacctggctgccggtgtccacggattatcgccagagg
aacgtgaagaccgagcgcggcgtgtccttgagccacctgaacgtgttcaagcgtctgcag
cagctccgccaggagcccagcattgaggaaggatccgccgaggtcaaggctgttagcaac
tacgtcctagccgtcaagcgccacctgagcggcgacttcgtctacatctctctcttcaac
atcttcgactccatcgagaatgtgaacctgtccaatgtgtttggcagcctgcccgccaag
ttccagtacgccctggtcaccgagaagtccatcaagaaggtcggcgaccaggtgtccgcc
ggcagcgtcaccctcatgccccacgaggccattgtgctgcgttccacaacaactgcttag

DBGET integrated database retrieval system