KEGG   Drosophila simulans: Dsimw501_GD10809
Entry
Dsimw501_GD10809  CDS       T01065                                 

Gene name
Dsim_GD10809
Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K20017  Bcl-2 family protein
Organism
dsi  Drosophila simulans
Pathway
dsi04214  Apoptosis - fly
dsi04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dsimw501_GD10809 (Dsim_GD10809)
   04215 Apoptosis - multiple species
    Dsimw501_GD10809 (Dsim_GD10809)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 6734031
NCBI-ProteinID: XP_016027048
FlyBase: FBgn0182572
UniProt: A0A0J9TZ51
LinkDB
Position
2R
AA seq 299 aa
MPGTSYPTNNDNFSNGFPMATTQSERLLQAQNRRKFSFPATLHSASLLEVGGGPKETTRR
RLSNVSDAVTRKLSYTIGWKAAQIPAQDIISQGRCLCGHYIKRRLRRSGLFNKKLGLQRI
RSILGSTSMGIVRDVFPAVQVLGDELERMHPRIYNGVARQICRNPGGEFHTPDAVSLLLG
AVGRELFRVEITWSKVISLFAIAGGLSVDCVRQGHPEYLPKLMESVSEVIEDELVPWINE
NGGWSGINTHVLPTTNSLNPLEWTTLVIGVVFGLILVFMILRFIFNLIVPKIYQRFTNS
NT seq 900 nt   +upstreamnt  +downstreamnt
atgcccggcacctcgtatcccacgaataacgataatttcagcaacggatttccgatggcc
accacacaaagtgagcgcctcttgcaggcccagaatcgaagaaagttcagttttccagcc
acactgcattccgcatcccttctggaggtgggtggtggtcccaaggagaccacgaggcgg
aggttgagcaatgtcagcgatgccgtcaccaggaaactctcctacacgattggctggaag
gcggcacagattccagcgcaggatatcatttctcagggtcgttgcctgtgcggtcattat
atcaagagacgtctcagaagatccggtttgttcaacaaaaagctgggactgcagcgcata
cgtagcatactgggctccacctccatgggcattgtgcgcgatgtgtttccagcggtccaa
gtgctgggcgatgaactggagcgcatgcatccccggatatacaacggagtagctcgtcag
atttgccggaatccgggtggtgagttccatactccggatgctgtgagcttgcttttggga
gccgtgggtcgcgagctcttccgtgtggagattacgtggagcaaggtgatctctctgttc
gccatcgccggtgggctgtccgttgattgtgtgcgccaaggacatccggaatacttgccc
aagctgatggagagcgtttccgaggtgatcgaagatgagctggtgccgtggattaacgag
aatggtggttggagtggcatcaacacacacgttttacccaccaccaacagcctgaatcct
ttagagtggaccactttggtcataggcgtggtttttggcctaattttagtttttatgatt
ctgcgatttatatttaacttgattgtaccaaaaatataccaacgatttacgaattcctaa

DBGET integrated database retrieval system