KEGG   Drosophila simulans: Dsimw501_GD11774
Entry
Dsimw501_GD11774  CDS       T01065                                 

Gene name
Dsim_GD11774
Definition
(RefSeq) uncharacterized protein
  KO
K20008  death caspase-1 [EC:3.4.22.-]
Organism
dsi  Drosophila simulans
Pathway
dsi04214  Apoptosis - fly
dsi04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dsimw501_GD11774 (Dsim_GD11774)
   04215 Apoptosis - multiple species
    Dsimw501_GD11774 (Dsim_GD11774)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dsi01002]
    Dsimw501_GD11774 (Dsim_GD11774)
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     Dsimw501_GD11774 (Dsim_GD11774)
Peptidases and inhibitors [BR:dsi01002]
 Cysteine peptidases
  Family C14: caspase family
   Dsimw501_GD11774 (Dsim_GD11774)
SSDB
Motif
Pfam: Peptidase_C14 DUF4347
Other DBs
NCBI-GeneID: 6735898
NCBI-ProteinID: XP_002082808
FlyBase: FBgn0183513
UniProt: B4QIR5
LinkDB
Position
2R
AA seq 323 aa
MTDECVTRNYGVGILSPNGSENRGSFLMADNTDAKGCTPQSLVVGGATAESPLPANKFVA
RMPVERYASEYNMSHKHRGVALIFNHEFFDIPSLKSRTGTNVDAQELKKAFENLGFAVSV
HKDCKLRDILKHVEKAAELDHTDNDCLAVAILSHGEHGYLYAKDTQYKLDNIWHYFTATF
CPSLAGKPKLFFIQACQGDRLDGGITLEKGVTETDGESSTSYKIPIHADFLFSYSTIPGY
FSWRNINNGSWYMQSLIRELNANGKKYDMLTLLTFVNQRVALDFESNVPATPMMDRQKQI
PCLTSMLTRILRFGDKPNGNKAG
NT seq 972 nt   +upstreamnt  +downstreamnt
atgaccgacgagtgcgtaaccagaaactacggagttggcattctcagcccgaacggatcg
gaaaatcggggcagctttcttatggctgataataccgatgccaagggctgtacgccgcag
tctcttgttgttggtggtgcaactgcagagagccccttgccggccaacaagtttgtggct
cgaatgcccgtggagcgctatgccagcgaatacaacatgagtcacaagcaccgcggagta
gcgctgatcttcaaccacgaattcttcgacataccctcgctgaagagccgcaccggaacg
aatgtcgatgcccaggagctgaagaaggcctttgaaaacctgggattcgcggtgtccgta
cacaaggactgcaagttgagggacatcctgaagcacgtggagaaggccgccgagctggat
cacacggacaacgactgccttgcggtggccatactctcgcacggggagcacggctaccta
tacgccaaggatacgcagtacaagctggacaacatctggcactacttcactgccaccttc
tgcccctcgctggcgggcaagccgaagctgttcttcatccaagcctgccagggcgaccgt
ttggacggagggatcaccctggagaagggcgttaccgagacggacggggagtcctcgact
agctacaagataccaatacacgccgactttctcttctcctactcgaccattccgggctac
ttctcctggcgcaacatcaacaacggctcctggtacatgcagtcgctgatccgcgagctg
aacgcaaatggcaaaaagtacgacatgctcaccctgctcacattcgttaaccagcgcgta
gccctagactttgagtcgaacgtgcccgccacaccgatgatggatcgccagaagcagata
ccgtgcctcacctccatgctgacgcgcatactgcgcttcggcgacaagccgaacgggaat
aaggctggctag

DBGET integrated database retrieval system