KEGG   Drosophila simulans: Dsimw501_GD12346
Entry
Dsimw501_GD12346  CDS       T01065                                 

Gene name
Dsim_GD12346
Definition
(RefSeq) uncharacterized protein
  KO
K20014  cell death protein rpr
Organism
dsi  Drosophila simulans
Pathway
dsi04214  Apoptosis - fly
dsi04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dsimw501_GD12346 (Dsim_GD12346)
   04215 Apoptosis - multiple species
    Dsimw501_GD12346 (Dsim_GD12346)
SSDB
Motif
Pfam: Bunya_NS-S
Other DBs
NCBI-GeneID: 27206211
NCBI-ProteinID: XP_016032420
FlyBase: FBgn0184078
UniProt: B4QPF6
LinkDB
Position
3L
AA seq 65 aa
MAVAFYIPDQATLLREAEQKEQQILRLRESQWRFLATVVLETLRHYSTCHPKTGRKSGKY
RKPSQ
NT seq 198 nt   +upstreamnt  +downstreamnt
atggcagtggcattctacatacccgatcaggcgactctgttgcgggaggcggagcagaag
gagcagcagatcctccgcttgcgggagtcccagtggagattcctggccaccgttgtcctg
gaaacgctgcgccactacagtacatgtcatccgaagaccggaagaaagtccggcaaatat
cgcaagccatcgcaatga

DBGET integrated database retrieval system