KEGG   Drosophila simulans: Dsimw501_GD12347
Entry
Dsimw501_GD12347  CDS       T01065                                 

Gene name
Dsim_GD12347
Definition
(RefSeq) uncharacterized protein
  KO
K20018  cell death protein Grim
Organism
dsi  Drosophila simulans
Pathway
dsi04214  Apoptosis - fly
dsi04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dsimw501_GD12347 (Dsim_GD12347)
   04215 Apoptosis - multiple species
    Dsimw501_GD12347 (Dsim_GD12347)
SSDB
Motif
Pfam: TFIIA DUF2367
Other DBs
NCBI-GeneID: 27206212
NCBI-ProteinID: XP_016032419
FlyBase: FBgn0184079
UniProt: B4QPF5
LinkDB
Position
3L
AA seq 136 aa
MAIAYFIPDQAQLLARSYQQNGQQAAASPRTTATPAAPPQQQQQSQQQQQQQHHQQQRPQ
FRANISVPLGSQQGSMTMSEFGCWDLLAQIFCYALRIYSYSSSQRQPTVIQISFEISSGG
QNNDEDNVTDATSKEN
NT seq 411 nt   +upstreamnt  +downstreamnt
atggccatcgcctatttcatacccgaccaggcccaattgttggccagaagctatcagcaa
aacggccagcaggcagcagcgagtccaaggacaactgcaacacctgctgcaccaccgcag
cagcagcaacaatcgcaacagcagcagcagcaacaacatcatcagcaacagcgccctcaa
ttccgtgccaatatttccgtgccgctgggaagtcaacagggatcgatgaccatgtcggag
tttggatgctgggatcttttggcgcagatcttttgctacgccctgcgaatctacagctac
agttcgagccagcgacaaccgacggtcattcagatatctttcgaaatcagcagcggcggt
cagaacaacgatgaggacaacgtgaccgatgccacctccaaggaaaactaa

DBGET integrated database retrieval system