KEGG   Drosophila simulans: Dsimw501_GD12350
Entry
Dsimw501_GD12350  CDS       T01065                                 

Gene name
Dsim_GD12350
Definition
(RefSeq) uncharacterized protein
  KO
K20016  cell death protein hid
Organism
dsi  Drosophila simulans
Pathway
dsi04013  MAPK signaling pathway - fly
dsi04214  Apoptosis - fly
dsi04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dsimw501_GD12350 (Dsim_GD12350)
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dsimw501_GD12350 (Dsim_GD12350)
   04215 Apoptosis - multiple species
    Dsimw501_GD12350 (Dsim_GD12350)
SSDB
Other DBs
NCBI-GeneID: 6738555
NCBI-ProteinID: XP_002085360
FlyBase: FBgn0184082
UniProt: B4QPF1
LinkDB
Position
3L
AA seq 410 aa
MAVPFYLPEGGADDVASSSSGASGNSSPHNHPLPSSASSSVSSSGVSSASASSASSSSSA
SSDGASSAASQSPNTTTSSATQTPMQSPLPTDQVLYALYEWVRMYQSQQSAPQIFQYPPP
SPSCNFTGGDVFFPHGHPNPNSNPHPRTPRTSVSFSSGEEYNFFRQQQPQPHPSYPAPST
PQPMPPQSAPPMHCSHSYPQQSAHMMPHHSAPYGMGGNYYAGYTPPPTPNTASAGTSSSS
AAFGWHGHLYSPLTSTSTPLSAPVAPKMRLQRSQSDAARRKRLTSTGEDEREYQSDHEAT
WDEFGDRYDNFTAGRERLQEFNGRIPPRKKKSSNSHSTSGNNPVCHTDSQPGGTSQAESG
AIHGHISQQRQVERERQKAKAEKKKPQSFTWPTVVTVFVLAMGCGFFAAR
NT seq 1233 nt   +upstreamnt  +downstreamnt
atggccgtgcccttttatttgcccgagggcggcgccgatgacgtagcgtcgagttcatcg
ggagcctcgggcaactcctccccccacaaccacccacttccctcgagcgcatcctcgtcc
gtctcctcctcgggcgtgtcctcggcctccgcctcctcggcctcgtcttcgtcctccgca
tcgtcggacggcgccagcagcgccgcctcgcaatcgccgaacaccaccacctcgtcggcc
acgcagacgccgatgcagtctccactgcccaccgaccaagtgctatacgccctgtacgag
tgggtcaggatgtaccagagccagcagagcgccccgcaaatcttccagtatccgccgcca
agcccctcttgcaatttcacgggcggcgatgtgttctttccgcacggccatccgaatccg
aactcgaatccccatccgcgcaccccccgaaccagcgtgagcttctcctccggcgaggag
tacaacttcttccggcagcagcagccccagccacatccgtcgtatccggcgccatcaaca
ccgcagccaatgccaccgcagtcagcgccgccgatgcactgcagccacagctacccgcag
cagtcggcgcacatgatgccacaccactccgctccctacggtatgggcggtaactactac
gccggctacacgccgccacccactccgaacacggccagtgcgggcacctccagctcatcg
gcggccttcggctggcacggccacctctacagccccctcacgtcgacctccacgccgtta
tcggcgccagtggcgcccaagatgcgcctgcagcgcagccagtcggatgcggccagacgc
aagcgattgacctcgacgggcgaggatgagcgcgagtaccagagcgatcatgaggccact
tgggacgagtttggcgatcgctacgacaactttacggccggccgggagcgtctgcaggag
ttcaatggacgtatcccgccccggaagaagaagagctccaatagccactcgaccagcggc
aataatccagtctgccataccgacagccagcccggtggtacatcccaagcggagagcggt
gccatccatggccacatcagtcagcagcgacaggtggagcgagagcgacaaaaggcgaag
gccgagaagaagaaaccacagagcttcacttggccaactgttgtgaccgtttttgttttg
gccatgggctgtggcttctttgcggcgcgatga

DBGET integrated database retrieval system