KEGG   Drosophila simulans: Dsimw501_GD12763Help
Entry
Dsimw501_GD12763  CDS       T01065                                 

Gene name
Dsim_GD12763
Definition
(RefSeq) GD12763 gene product from transcript GD12763-RB
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
dsi  Drosophila simulans
Pathway
dsi00020  Citrate cycle (TCA cycle)
dsi00190  Oxidative phosphorylation
dsi01100  Metabolic pathways
dsi01200  Carbon metabolism
Module
dsi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dsi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dsi_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dsimw501_GD12763 (Dsim_GD12763)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Dsimw501_GD12763 (Dsim_GD12763)
Enzymes [BR:dsi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Dsimw501_GD12763 (Dsim_GD12763)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 FAD_binding_3 GIDA HI0933_like DAO
Motif
Other DBs
NCBI-GeneID: 6737738
NCBI-ProteinID: XP_016031517
UniProt: A0A0J9UJH7
LinkDB All DBs
Position
3L
AA seq 651 aa AA seqDB search
MNRLFVRRAGQHVTRSLFGPNASRLPQVTCVRDACCKDEYSLIDHKFDAIVIGAGGAGMR
AGFGLAEKGFQTAIISKLFPTRSHTVAAQGGVNAALSNMDKDDWKYHFYDTVKGSDWLGD
QNAIHYMCREAEKAVCELDMYGMPFSRKPDGKIYQRPFGGQTLDYGKGGVARRACACADR
TGHALIHTLYGQTLKHSDSCHYFVDYFVLDLIMSQGACVGCLAWKLDDGTFHRFLAKNTV
VAAGGCGRVYFSTTAGHTCTGDGNAWVSRQELPLMDMEFVQFHPTGIYGAGCLITEGVRG
EGGFFLNCKGERFMERYAPKAKDLASRDVVARAMTMEVLAGNGCGPLKDHVHLQLHHIDA
KIIKQRLPGIMVTARIFAKVDVTKEPVPVLPTVHYNMGGIPTDYKGRVVTIDENGKEQVV
KGLYSCGETSCASVHGANRLGANSLLDLIIFGRVCALDIAANSCPGDKPPQVEDKATEKS
LDNFKRLRCADGCIPTAALRMELQRTMTKHAAVFREGKLLKEGLLKVAELCEQFKDIKTT
DRTMVWNSNLVETLELQNMLANAVHIITAMENRKESRGSHAREDFKTRVDELDYGAPLAG
QKKKPFEEHWRKHTMTFALGNKGCASIKYRPVVDTTLDSSVAPIPPAPRTY
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgcctgtttgtcagaagggcgggacagcatgtaaccaggagtctttttggtcca
aatgcaagtcgtctgcctcaagtgacctgcgttcgagatgcgtgttgcaaggatgagtac
tccttgatagaccacaagttcgatgcgattgtgattggtgccggtggagctggaatgcgg
gctggctttggcctggcggagaagggtttccaaacggccattatatcaaagctatttccc
acccgatctcacacggtggctgcccagggtggtgttaatgccgccctctcaaatatggac
aaggacgactggaagtaccacttctacgacacggtgaagggctccgattggctgggtgat
cagaacgcgatccattatatgtgtcgggaggcggagaaggcggtctgcgaactggacatg
tacgggatgcccttctcgcgaaagcccgatggcaagatctaccagcgaccttttggtggt
caaaccttggactacggaaagggcggtgtggccaggagggcgtgtgcatgcgcagatcgc
acgggtcacgccctcatccacacactgtacggacaaacgctgaagcactcggattcttgc
cactattttgtggactacttcgtcctggatctgatcatgtcgcagggtgcatgtgtggga
tgtttggcctggaaactggatgatggcaccttccatcggtttctggccaaaaatacggtt
gttgccgccggcggttgtggtcgggtttacttctccacgaccgccggacacacgtgtacc
ggcgatggcaatgcctgggtttccagacaggagctgccgctcatggacatggagtttgtg
cagtttcatccaactggaatctacggagccggatgccttatcaccgagggagttagaggc
gaaggcggtttcttcttgaactgcaagggagaacgtttcatggaacgctatgccccaaag
gccaaggatctggcgtccagggacgtggtggcgcgagccatgaccatggaggttcttgct
ggcaatggttgtggtccgctcaaggatcatgtgcacctgcagctccaccatatcgacgcc
aagatcatcaagcaacgattgccgggcattatggtcaccgccaggatttttgcaaaagtg
gacgtgaccaaggaaccagtaccagtgctgccaactgtgcactacaacatgggcggcata
ccaacggattacaagggtcgtgtggtcaccatcgatgagaatggcaaggaacaggtggtc
aaggggctgtactcctgtggggaaacctcctgcgcctcagtacacggagcaaatcgattg
ggtgccaactccctgctggatctgatcatctttggccgcgtctgtgccttggacattgcc
gcaaacagctgtccgggggataagccgccccaggtggaggacaaggccacggagaagtcg
ctggataactttaagcgcctgcgatgcgccgacggatgtattcccactgcggcgttgaga
atggaactgcagcgcaccatgaccaaacatgcggctgttttccgggagggaaaactgctc
aaggagggtctgctcaaagtggccgagttgtgcgaacagttcaaggacatcaagacaacc
gatcgtacaatggtgtggaactccaacctagttgaaacgctggagctgcagaatatgctg
gccaatgcggtgcacatcattacagccatggaaaatcgcaaggagtcgaggggctcccat
gctcgcgaggatttcaagacgcgcgtggatgagctggactacggagcaccactggccgga
cagaaaaagaaaccattcgaggagcattggcgcaagcacaccatgacctttgccctgggt
aacaaaggatgtgcctcgatcaaatatcgcccggttgtggacaccactttggacagctcc
gttgcacccattccacctgctccgcgcacctactga

DBGET integrated database retrieval system