KEGG   Drosophila simulans: Dsimw501_GD12814
Entry
Dsimw501_GD12814  CDS       T01065                                 

Gene name
Dsim_GD12814
Definition
(RefSeq) uncharacterized protein
  KO
K13647  procollagen-lysine,2-oxoglutarate 5-dioxygenase, invertebrate [EC:1.14.11.4]
Organism
dsi  Drosophila simulans
Pathway
dsi00310  Lysine degradation
dsi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    Dsimw501_GD12814 (Dsim_GD12814)
Enzymes [BR:dsi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.4  procollagen-lysine 5-dioxygenase
     Dsimw501_GD12814 (Dsim_GD12814)
SSDB
Motif
Pfam: 2OG-FeII_Oxy Anp1 2OG-FeII_Oxy_3
Other DBs
NCBI-GeneID: 6737639
NCBI-ProteinID: XP_002084471
FlyBase: FBgn0184540
UniProt: B4QPR5
LinkDB
Position
3L
AA seq 721 aa
MRIQQSALLLLLLAVTSQGDAESNWNDKIKVFTVATEPTDGYTRYIRSARVYDIEVTTLG
LGEEWKGGDMQKPGGGFKLNLLREAIAPYKNEPETIILFTDSYDVIITTTLDEIFEKFKE
AGAKILFSAEKYCWPDKSLANDYPEVEGKASRFLNSGAFIGYAPQVFALLEDPIEDTADD
QLYFTKIFLDETKRTKLGLKLDVQSRLFQNLHGAKNDVKLKVDLESNQGVLQNVDFMTTP
AIIHGNGLSKVDLNAYGNYLARTFSGVCLLCQENLLDLEETNLPVISLALMVTQPVPFFD
QFLEGIESLNYPKKKLHLLIYSNVAFHDDDIKSFVNKYDKEYATAKFALSTDELDERQGR
QLALDKARLHQSDYIFFVDADAHIDDSEVLRELLRLNKQFVAPIFSKHKELWSNFWGALS
EGGYYARSHDYVDIVKRELIGMFNVPHVTSIYLVKKTAFDAISFKHKEFDPDMAMCESLR
NAGIFMYASNLRIFGHLVNADDFNTTVTRPDFYTLFSNEIDWTEKYIHPNYSLQLNESNK
IQQPCPDVYWFQIVSDAFCDDLVAIMEAHNGWSDGSNSDNRLEGGYEAVPTRDIHMKQVG
LERLYLKFLQLFVRPLQERAFTGYFHNPPRALMNFMVRYRPDEQPSLRPHHDSSTYTINI
AMNRAGIDYQGGGCRFIRYNCSVTDTKKGWMLMHPGRLTHYHEGLLVTNGTRYIMISFID
P
NT seq 2166 nt   +upstreamnt  +downstreamnt
atgagaatacaacaaagcgccttgttgttgttgctgctggccgtgacgtcgcaaggagac
gccgagtccaattggaatgacaaaatcaaagtgttcactgtggccactgaacccaccgat
ggctatactagatatattcgatccgcacgcgtctacgatattgaggtgaccacccttggc
ttgggagaggaatggaaaggaggagatatgcaaaagccaggcggcggattcaagctcaat
cttctgcgcgaagctatagcaccgtataaaaatgaacccgaaacaatcatactcttcaca
gacagctacgatgtgattatcaccaccacgctggatgagatctttgagaaattcaaggag
gcgggtgccaagatactcttctccgcagagaaatactgctggcccgacaagagtctggcc
aatgactatcccgaagtggagggcaaggcctcgcgattcctcaattcgggcgccttcatt
ggttatgcaccacaagttttcgctctgctggaggatccaattgaagacactgccgacgat
cagttgtatttcacaaagatcttcctcgacgagaccaaacgcaccaagctgggcttaaag
ctggacgtacaatcgcgcctattccaaaacctacatggtgccaagaacgatgtgaagctt
aaagtggatctcgagagcaatcagggcgttctgcagaacgtggatttcatgacgacaccg
gccatcattcatggcaatggacttagcaaagtggatctgaatgcatatggcaattatttg
gccaggacttttagtggcgtctgccttttgtgtcaggaaaatctattggacttggaagag
acaaacctacctgtgatttcccttgccctgatggtcacgcaacccgtacccttcttcgac
cagtttctggagggcatcgagagcctaaactatcccaagaaaaaactccacttgctcatc
tacagcaatgttgcatttcacgacgatgacatcaagtcgtttgtaaacaaatatgacaaa
gagtatgctactgccaagtttgctctctccactgacgagttggatgaacgccagggcagg
cagttggcccttgacaaggctcgactccaccagagtgattatatattcttcgtggatgca
gatgcgcacatcgacgacagcgaggttctccgggagctgctcaggctgaacaagcaattc
gtggctccgattttctccaagcacaaggagctgtggagcaacttctggggcgctctttcc
gagggtggctactatgccaggtcgcacgactacgtggacattgtaaagcgggaacttatt
ggaatgttcaatgtgccccatgtaacgagcatatatctggtgaagaaaaccgccttcgat
gccatctccttcaagcacaaggaattcgatcccgacatggccatgtgcgagtcactccgg
aatgcgggtatcttcatgtacgccagcaatctgcgcatattcggtcacttggtcaacgcc
gatgacttcaacacgacggtgacacgtccggacttctatacgttgtttagcaacgagatc
gactggacggagaagtacatacacccgaactactcactccagctgaacgagagcaacaag
atacagcagccgtgcccggatgtctattggttccagatcgtgtcggacgcgttctgcgac
gatttggtggccatcatggaggcgcacaacggctggtcggacggcagcaacagcgacaat
cggctggagggcggatacgaggcggtgcccaccagggacatccacatgaagcaggtgggc
ctggaacggctctacctcaaatttctccaactgttcgttcgtccgctgcaggagcgcgcc
ttcacgggttacttccacaatcctccacgcgcgctgatgaacttcatggtgcgttatcgg
ccggatgaacagccttcactgcgaccccaccacgactcctcaacgtacaccatcaacatt
gcgatgaaccgggcgggtattgactatcagggcggtggctgtcgattcattcggtacaac
tgctccgtgaccgatacgaagaagggatggatgctgatgcacccggggcgactgacccac
taccacgaggggctgctagtgaccaatggcacgcgttacatcatgatttccttcatcgat
ccatag

DBGET integrated database retrieval system