KEGG   Drosophila simulans: Dsimw501_GD15392Help
Entry
Dsimw501_GD15392  CDS       T01065                                 

Gene name
Dsim_GD15392
Definition
(RefSeq) GD15392 gene product from transcript GD15392-RB
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
dsi  Drosophila simulans
Pathway
dsi04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    Dsimw501_GD15392 (Dsim_GD15392)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:dsi01002]
    Dsimw501_GD15392 (Dsim_GD15392)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dsi04147]
    Dsimw501_GD15392 (Dsim_GD15392)
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     Dsimw501_GD15392 (Dsim_GD15392)
Peptidases [BR:dsi01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   Dsimw501_GD15392 (Dsim_GD15392)
Exosome [BR:dsi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dsimw501_GD15392 (Dsim_GD15392)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 6739382
NCBI-ProteinID: XP_002076291
UniProt: A0A0J9TZ10
LinkDB All DBs
Position
2R
AA seq 252 aa AA seqDB search
MAVYGIVATVLALLLLGDASDAETTGRIIGGSDQVIRNAPWQVSIQISARHECGGVIYSK
EIIITAGHCLHERSVTLMKVRVGAQNHNYGGTLVPVAAYKVHEQFDSRFLHYDIAVLRLS
TPLTFGLSTRAINLASKSPTGGTTVTVTGWGHTDNGALADSLQKAQLQIIERGECASQKF
GYGSDFVGEETICAASTNADACTGDSGGPLVASSQLVGIVSWGYRCADDNYPGVYADVAI
LRPWIVKAANAI
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggctgtttacggaatagtggctacggtgctggcccttttgctgctcggcgatgcgtca
gatgccgagaccactggacgaattattggcggaagcgaccaggtgattcgtaacgccccc
tggcaggtgtctattcagatcagtgcgcgccacgagtgcggcggagtcatctatagcaag
gagatcatcatcacggccggacactgtctgcatgagcgatccgtgacgctgatgaaggtg
cgtgtgggtgcacagaatcacaactacggcggcacattggttcctgtggcggcctacaaa
gtccacgagcagtttgattcccgcttcctgcactacgacattgccgtgcttcgtctgtcc
actccactgacctttggcctctcaaccagagccatcaatttggccagtaagagtccaacg
ggtggaacgacagtcactgtcaccggttggggccacactgataatggagccctcgccgat
agcttgcagaaggcccagctgcagatcatcgaacgcggggagtgtgcctcgcaaaagttt
ggctacggttcggattttgtgggcgaggaaacaatttgcgctgccagcactaatgcagat
gcctgtacaggcgactctggaggtcctttggtggccagtagccagctggtgggcattgta
tcctggggttaccggtgtgcggacgacaactaccccggtgtctatgccgatgtggccatt
ctgcgtccttggatagtcaaggcggccaatgccatatga

DBGET integrated database retrieval system