KEGG   Drosophila simulans: Dsimw501_GD15392Help
Entry
Dsimw501_GD15392  CDS       T01065                                 

Gene name
Dsim_GD15392
Definition
(RefSeq) uncharacterized protein
Organism
dsi  Drosophila simulans
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 6739382
NCBI-ProteinID: XP_002076291
FlyBase: FBgn0187060
UniProt: A0A0J9TZ10
LinkDB All DBs
Position
2R
AA seq 252 aa AA seqDB search
MAVYGIVATVLALLLLGDASDAETTGRIIGGSDQVIRNAPWQVSIQISARHECGGVIYSK
EIIITAGHCLHERSVTLMKVRVGAQNHNYGGTLVPVAAYKVHEQFDSRFLHYDIAVLRLS
TPLTFGLSTRAINLASKSPTGGTTVTVTGWGHTDNGALADSLQKAQLQIIERGECASQKF
GYGSDFVGEETICAASTNADACTGDSGGPLVASSQLVGIVSWGYRCADDNYPGVYADVAI
LRPWIVKAANAI
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggctgtttacggaatagtggctacggtgctggcccttttgctgctcggcgatgcgtca
gatgccgagaccactggacgaattattggcggaagcgaccaggtgattcgtaacgccccc
tggcaggtgtctattcagatcagtgcgcgccacgagtgcggcggagtcatctatagcaag
gagatcatcatcacggccggacactgtctgcatgagcgatccgtgacgctgatgaaggtg
cgtgtgggtgcacagaatcacaactacggcggcacattggttcctgtggcggcctacaaa
gtccacgagcagtttgattcccgcttcctgcactacgacattgccgtgcttcgtctgtcc
actccactgacctttggcctctcaaccagagccatcaatttggccagtaagagtccaacg
ggtggaacgacagtcactgtcaccggttggggccacactgataatggagccctcgccgat
agcttgcagaaggcccagctgcagatcatcgaacgcggggagtgtgcctcgcaaaagttt
ggctacggttcggattttgtgggcgaggaaacaatttgcgctgccagcactaatgcagat
gcctgtacaggcgactctggaggtcctttggtggccagtagccagctggtgggcattgta
tcctggggttaccggtgtgcggacgacaactaccccggtgtctatgccgatgtggccatt
ctgcgtccttggatagtcaaggcggccaatgccatatga

DBGET integrated database retrieval system