KEGG   Drosophila simulans: Dsimw501_GD16405Help
Entry
Dsimw501_GD16405  CDS       T01065                                 

Gene name
Dsim_GD16405
Definition
(RefSeq) uncharacterized protein, isoform B
  KO
K02105  catenin beta 1
Organism
dsi  Drosophila simulans
Pathway
dsi04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Dsimw501_GD16405 (Dsim_GD16405)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arm Adaptin_N HEAT_2 Cnd1 KAP Arm_2 Atx10homo_assoc PUL
Motif
Other DBs
NCBI-GeneID: 6724897
NCBI-ProteinID: XP_016037731
FlyBase: FBgn0188022
LinkDB All DBs
Position
X
AA seq 843 aa AA seqDB search
MSYMPAQNRTMSHNNQYNPPDLPPMVSAKEQTLMWQQNSYLGDSGIHSGAVTQVPSLSGK
EDEEMEGDPLMFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRVRAAMFPETLEEGIEIPST
QFDPQQPTAVQRLSEPSQMLKHAVVNLINYQDDAELATRAIPELIKLLNDEDQVVVSQAA
MMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIF
KSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVK
FLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSS
NKPAIVDAGGMQALAMHLGNMSPRLVQNCLWTLRNLSDAATKVEGLEALLQSLVQVLGST
DVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTIINAGDREEITEPAVCALRHLT
SRHVDSELAQNAVRLNYGLSVIVKLLHPPSRWPLIKAVIGLIRNLALCPANHAPLREHGA
IHHLVRLLMRAFQDTERQRSSIATTGSQQPSAYADGVRMEEIVEGTVGALHILARESHNR
ALIRQQSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAEIIEQEGATGPLTDLLHSR
NEGVATYAAAVLFRMSEDKPQDYKKRLSIELTNSLLREDNNIWASADLGMGPDLQDMLGP
EEAYEGLYGQGPPSVHSSHGGRAFHQQGYDTLPIDSMQGLEISSPVGGGGAGGAPGNGGA
VGGASGGGGNIGAIPPSGAPTSPYSMDMDVGEIDAGALNFDLDAMPTPPNDNNNLAAWYD
TDC
NT seq 2532 nt NT seq  +upstreamnt  +downstreamnt
atgagttacatgccagcccagaatcgaaccatgtcgcataataatcaatacaatccacct
gatctgccgccgatggtgtccgccaaggagcagaccctcatgtggcagcagaattcatac
ttgggcgactccggcatccactcgggtgccgtgacccaggtgccatcgctgtcgggcaag
gaggacgaggagatggagggagatccacttatgttcgacctggacaccggtttcccgcag
aatttcacacaagaccaagtggacgatatgaaccagcagctgagccagacgcgctcccaa
cgtgtacgtgctgccatgtttccggaaaccctggaggagggcattgagattccctccacc
cagtttgatccccaacagccgacggcagtccaacgtctttcggaaccgtcgcaaatgcta
aagcacgcggtggtcaatctgatcaactaccaggacgacgctgagctggcaaccagggcc
atacccgagttaatcaagctgctgaacgatgaggaccaggtggtagtttcccaagccgcc
atgatggtccaccagctgtccaagaaggaggcctcgcgtcacgccattatgaacagccct
cagatggtagccgctttggtgcgtgccatctctaacagcaacgatctggagagcaccaag
gcagcggtaggaacgctgcacaacttatcacaccatcgccagggtctgctggccatcttc
aagagtggcggcatcccggcactcgtcaagttgctctcctcgccagtggagagtgtgctg
ttctatgcaattaccacgctgcacaatttgctgctccaccaggatggctctaagatggct
gtgcgcctggccggtgggcttcagaagatggttactctgctgcaacgaaacaacgtcaag
tttctggctatcgtcacagattgcttgcaaattctggcctatggtaaccaggagagcaag
ttaataatccttgcctccggcggacccaacgaactcgtgcgcatcatgcgctcctacgac
tacgagaagctactgtggaccacttcgcgggtactgaaagtgctctccgtttgctccagc
aacaagccggccatcgtggatgccggtggaatgcaggcgctggctatgcacttgggtaac
atgtcgccgcgccttgtgcaaaactgtttgtggacgctccgcaatctgtcggatgcagcc
actaaggtggagggcctcgaagctttgctccaatctctcgtccaggttctgggctcgacc
gatgtcaacgtggtcacctgtgccgccggtatcctttcaaatctgacgtgcaacaatcag
cgcaacaaggccaccgtttgccaggtgggtggtgtggacgccctcgtccgtactattatt
aacgctggagatcgtgaagaaattaccgagccggctgtctgtgccctacgtcacttgacc
tcgcgtcatgtagactctgagttggcccaaaatgccgtacgcctaaactacggactatcg
gtgattgtaaagctattgcatccaccatcacgctggcccttgatcaaggccgtcattgga
ctcatacgcaatttggccctctgtccggccaatcacgccccgttgcgggagcacggggcc
atccaccatctagtgcggctgcttatgcgcgccttccaagacacagagaggcaacgttcc
tcgatagccaccacgggctcacagcagccgtccgcatacgctgacggcgttcgcatggag
gagattgtcgagggcacggtgggggcgctacatatcctggcccgcgagtcccacaaccgg
gcactcattcgccagcagtcggtaataccgatctttgtacgattgctgttcaacgaaatc
gagaacatacagcgcgtggctgctggcgttctttgtgagctcgccgctgacaaggagggc
gccgagattatcgagcaggagggcgccactgggccgctgaccgatctcctgcactcgcgc
aatgaaggcgtggccacatacgccgccgccgttctcttccgcatgagtgaggacaagccg
caggattacaagaagcggctatccatagagctgaccaactcgctgctgcgtgaggacaac
aacatatgggccagtgccgacctgggcatgggtcccgatctgcaggatatgcttggacca
gaagaagcatatgagggcctgtacggacaaggtccgcccagcgtgcacagttcgcacgga
ggtcgcgcattccatcaacaaggatatgatactctaccaatagattcgatgcagggtctg
gagatcagcagcccagtgggcggcggcggtgctggcggtgctcccggcaatggtggagct
gtgggcggagctagcggcggcggtggtaacatcggcgccattccgcccagcggcgcaccc
acttcgccctattccatggacatggacgttggcgagattgatgccggtgcattgaacttt
gacttggacgccatgccgacgccacccaatgacaacaacaacctggctgcctggtacgat
accgattgttag

DBGET integrated database retrieval system