KEGG   Drosophila simulans: Dsimw501_GD16975
Entry
Dsimw501_GD16975  CDS       T01065                                 

Gene name
Dsim_GD16975
Definition
(RefSeq) uncharacterized protein, isoform B
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
dsi  Drosophila simulans
Pathway
dsi03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    Dsimw501_GD16975 (Dsim_GD16975)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dsi01009]
    Dsimw501_GD16975 (Dsim_GD16975)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:dsi03021]
    Dsimw501_GD16975 (Dsim_GD16975)
   03019 Messenger RNA biogenesis [BR:dsi03019]
    Dsimw501_GD16975 (Dsim_GD16975)
   03041 Spliceosome [BR:dsi03041]
    Dsimw501_GD16975 (Dsim_GD16975)
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     Dsimw501_GD16975 (Dsim_GD16975)
Protein phosphatases and associated proteins [BR:dsi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     Dsimw501_GD16975 (Dsim_GD16975)
Transcription machinery [BR:dsi03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     Dsimw501_GD16975 (Dsim_GD16975)
Messenger RNA biogenesis [BR:dsi03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     Dsimw501_GD16975 (Dsim_GD16975)
Spliceosome [BR:dsi03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    Dsimw501_GD16975 (Dsim_GD16975)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 6725592
NCBI-ProteinID: XP_016038784
FlyBase: FBgn0188553
LinkDB
Position
X
AA seq 330 aa
MGDFDLNVDSLIQRLLEMRSCRTGKQVQMTEAEVRGLCLKSREIFLQQPILLELEAPLII
CGDIHGQYTDLLRLFEYGGFPPAANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLL
RGNHECASINRIYGFYDECKRRYNVKLWKTFTDCFNCLPVAAIIDEKIFCCHGGLCPDLQ
GMEQIRRLMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGVDVVSKFLNRHEL
DLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDNAGGMMTVDDTLMCSFQILKPSEK
KAKYLYSGMNSSRPTTPQRSAPMLATNKKK
NT seq 993 nt   +upstreamnt  +downstreamnt
atgggcgacttcgatctgaatgtggacagtttgatacagcggctgctggagatgcgcagc
tgccgaacgggcaagcaggtccagatgacggaggcggaggtgcgtggcctctgcctcaag
tcgcgcgagatcttcttgcaacagcccatcctgctggaactggaggcaccgctgatcatc
tgcggcgacattcacggccagtacacagacctgttgcgcctgttcgagtacggcggattc
cctccggctgccaactacttgttcctcggcgactacgtcgatcggggcaagcagtccctg
gagaccatctgcctgctgctggcctacaagatcaaatatccggagaacttcttcttgttg
cgcggcaaccacgagtgcgccagtattaataggatttacggcttctacgatgagtgcaag
cgccgatacaatgtcaaactgtggaagactttcacagattgtttcaactgtttgccggta
gccgccatcattgacgaaaagatcttctgctgccacggcggcctttgccccgatcttcag
ggcatggagcagatccgacgcctgatgcggcccacagatgtgccggataccgggctactg
tgcgatctcctgtggagtgatcccgacaaggatgttcagggctggggtgagaacgatcgc
ggtgtgagcttcacattcggcgtggatgtggtctccaagttcttgaaccggcacgagctg
gacttgatctgccgtgcacatcaggttgtggaggatggctacgagttctttgcgcgtcgg
caactggtcacgttgttctcggcgcccaattactgtggagagttcgacaacgccggcgga
atgatgaccgtggacgacacgcttatgtgctcattccagatcctgaaaccatccgagaag
aaggccaagtatctgtatagcggaatgaactcgtcgcgacccacaacaccgcagcgcagc
gccccaatgcttgcgaccaacaagaagaaataa

DBGET integrated database retrieval system