KEGG   Drosophila simulans: Dsimw501_GD16997Help
Entry
Dsimw501_GD16997  CDS       T01065                                 

Gene name
Dsim_GD16997
Definition
(RefSeq) uncharacterized protein, isoform A
Organism
dsi  Drosophila simulans
SSDB OrthologParalogGFIT
Motif
Pfam: SET zinc_ribbon_10
Motif
Other DBs
NCBI-GeneID: 6725640
NCBI-ProteinID: XP_002106647
FlyBase: FBgn0188574
LinkDB All DBs
Position
X
AA seq 532 aa AA seqDB search
MPGRKKNHHKNNNNNRARHQRGGQQSKDKQEQQEKEHSPSPTEEKELPYRVEHSDIYGRY
LVANRQLEAGETLIREEPLAIGPCVSGDPVCLGCYQPVSLKPDQYRCPGCAWPLCGSTCA
GLKHRHGHTETECQLYGERRAVAGKLLTERAGPAEVRDLYELVMIVRILLLRQHDPEQFA
LIARMESHTEERRQNAVLWRHYEEKVVQRLRVTWQLEDLEAEQVHEVCGILDVNCFEIGQ
NGAKARTLYPSAFLLAHDCTPNTAHTDDPRSFEILLRTSRRVREREALTLSYAYTLQGTL
KRRAFMHEGKLFWCCCRRCSDPRELGTDCSALVCATCRTGSVRAVDPLQQSGDWACDRCA
HKMGATEVERQLDRINNDLEDIDVHDIPGLENFLLRYRDVLRPNHYLLLSAKYSLCQIYG
RTEGYLLPQMSPEDIARKESYCREFLEIVDVLDPGLTRLRGLIMYELHAPVMVLAQSAFQ
SGQISRQEFQRRLKEVVKLLQVSRDILLMEPEGSTENAMGQAAADALSKMGC
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgccgggaagaaaaaaaaaccaccacaaaaacaacaacaacaacagagccagacaccag
cggggtggtcagcagtcgaaggataagcaggagcagcaggaaaaggagcacagtccatcg
ccgacggaggagaaggagctgccatatcgcgtagaacactccgatatatatggccgatat
ttggtggccaatcgccagctggaggcgggcgagacgctgatccgcgaggagccactggcc
attgggccgtgtgtgagcggtgatcccgtgtgcctgggctgctatcagccggtgtccctc
aagccggatcaataccgttgtcccggctgcgcctggccactatgcggcagcacgtgcgcg
ggcctcaaacatcggcatggtcacacggagacggagtgccaactgtacggggaacgacgg
gcggtcgccggcaaactgctgacggaacgcgccggtccggcggaagtgcgtgacctttac
gaactggtgatgatcgttcgcatactcctcctgcgccagcacgatccggagcagttcgct
ctgatcgcccgcatggaatcgcatacggaggagcgacgccagaacgcggtgctgtggcgc
cactacgaggagaaggtggtgcagcggctgcgcgtcacctggcagctggaggacctcgag
gcggagcaggtgcacgaggtgtgcggcatactggacgtcaattgcttcgagatcggccag
aatggcgccaaggcgcggacgctatatccgagcgccttcctgctcgcgcacgactgcaca
ccgaacacggcgcacacggacgacccgaggtccttcgagatcctgctgcgcacctcgcgg
cgcgtgcgcgagcgggaagcgctgacgctcagctatgcgtacacgctgcagggcacactc
aagcggcgcgccttcatgcacgagggcaagctcttctggtgctgctgccggcgctgctcc
gatccccgcgagctgggcaccgactgcagcgccctcgtgtgcgccacctgtcggacggga
tcggtgcgggcggtggatccactgcagcagagcggcgactgggcctgcgaccgttgcgcc
cacaaaatgggagccacggaagtggagcgccagttggaccgcatcaacaacgacctggag
gacattgatgtccacgatattccaggactggagaactttctccttagatatcgggatgtc
ctgcgaccgaatcactacctcctgctctcggccaaatattccttgtgccagatttacggt
cggactgaaggatacctactgccacagatgtccccagaggacattgcccgcaaggagagc
tactgccgcgagttcctggaaatcgtagacgtactcgatccgggtctgacccgtctgcga
ggactcatcatgtacgagctgcatgcccccgtaatggtgttggcccagtcggcctttcaa
agcggacagatctcacgacaggagttccagcgacgactgaaggaggtcgtgaagctgctc
caagtgagcagggatatcctgctaatggaacccgaaggatctacggaaaatgcaatggga
caggctgcagccgatgcgctaagcaaaatgggttgctag

DBGET integrated database retrieval system