KEGG   Drosophila simulans: Dsimw501_GD17207Help
Entry
Dsimw501_GD17207  CDS       T01065                                 

Gene name
Dsim_HDAC6
Definition
(RefSeq) HDAC6
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
dsi  Drosophila simulans
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dsi01009]
    Dsimw501_GD17207 (Dsim_HDAC6)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dsi03019]
    Dsimw501_GD17207 (Dsim_HDAC6)
   04131 Membrane trafficking [BR:dsi04131]
    Dsimw501_GD17207 (Dsim_HDAC6)
   03036 Chromosome and associated proteins [BR:dsi03036]
    Dsimw501_GD17207 (Dsim_HDAC6)
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Dsimw501_GD17207 (Dsim_HDAC6)
Protein phosphatases and associated proteins [BR:dsi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dsimw501_GD17207 (Dsim_HDAC6)
Messenger RNA biogenesis [BR:dsi03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     Dsimw501_GD17207 (Dsim_HDAC6)
Membrane trafficking [BR:dsi04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    Dsimw501_GD17207 (Dsim_HDAC6)
Chromosome and associated proteins [BR:dsi03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     Dsimw501_GD17207 (Dsim_HDAC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zf-UBP zf-C3HC4_3
Motif
Other DBs
NCBI-GeneID: 6726010
NCBI-ProteinID: XP_016039385
FlyBase: FBgn0068659
LinkDB All DBs
Position
X
AA seq 1186 aa AA seqDB search
MSPPIVTRRGAQQAKIQTRAMASKSKTGTPGAPTAAGGSAGGISSSSGSISGGFNTADPR
KTNKPSAALLEAKRRARNNMLKNQGCGSQESVTDIFQNAVNSKSMVRKPTALIYDESMSQ
HCCLWDKEHYECPERFTRVLERCRELNLTERCLELPSRSATKDEILRLHTEEHFERLKET
SGIRDDERMEELSSRYDSIYIHPSTFELSLLASGSTIELVDHLVTGKAQNGMAIIRPPGH
HAMKAEYNGYCFFNNVALATRHALDVHKLQRILIIDYDVHHGQGTQRFFYNDPRVVYFSI
HRFEHGSFWPHLHESDYHAIGSEAGTGYNFNVPLNATGMTNGDYLAIFQQLLLPVALEFQ
PELIIVSAGYDAALGCPEGEMEVTPACYPHLLNPLLRLADARVAVVLEGGYCLDSLAEGA
ALTLRSLLGDPCPPLVETVPLPRAELAQALLSCIAVHRPHWRCLQLQQTYDCAELQDRDK
DEDLHTVLRHWMGGPPPVDRYPTRDTAIPLPPEKVVSNAARLQVLRAETKLSVPSVKVCY
AYDAQMLLHCNLNDTGHPEQPSRIQHIHKMHDDYGLLTQMKQLSARAATTDEVCLAHTRA
HVNTVRRLLGREPKELHDAAGVYNSVYLHPRTFDCAVLAAGSVLQAVDSVLRGESRSGIC
NVRPPGHHAEQDHPHGFCIFNNVAIAAQYAIRDFGLERVLIVDWDVHHGNGTQHIFESNP
KVLYISLHRYEHGSFFPKGPDGNFDVVGKGAGRGFNVNIPWNKKGMGDLEYALAFQQLVM
PIAYEFNPQLVLVSAGFDAAIGDPLGGCKVTPEGYGMLTHWLSALASGRIIVCLEGGYNV
NSISYAMTMCTKTLLGDPVPTPQLGATALQKPPTVAFQSCVESLQLCLQVQRTHWRSLEF
VGRRLPRDPVVGENNNEDFLTASLRHLNISNDDATVAASGPAVDRPDCGDERPSGSKPKV
KVKTLSDYLADNKEALEQSEMFAVYPLKTCPHLRLLRPEEAPRSLDSRAECSVCGSTGEN
WVCLSCRHVACGRYVNAHMEQHSVEEQHPLAMSTADLSVWCYACSAYVDHPRLYAYLNPL
HVDKFQEPMAWTHGCACREDGCYATGPDGRDEDDENNDDDNVAGSSICLRLERNNXPLAI
RVLDALTDYVCALCPPLRHLIQFLAEHLWPLLERIYLNLLHYFLAH
NT seq 3561 nt NT seq  +upstreamnt  +downstreamnt
atgagcccgcccatcgtcacgcgacggggtgcgcagcaggcgaagattcagacgcgggca
atggccagtaaatcgaagacgggcacgccaggggcgccgacggcggcgggtggctctgcc
ggcggcatcagcagcagcagcggcagtatcagcggcggatttaataccgccgatccgcga
aagacgaacaaaccgagcgcagcgctcttggaggcgaaacgtcgagcgcggaacaacatg
ctcaagaatcagggctgcggatcgcaggagagcgtcacggatatattccagaatgctgtc
aacagcaagagtatggtgcggaaacccacggcactgatctacgatgagtccatgagccag
cactgttgcctgtgggacaaggagcactacgagtgtcccgagcgcttcacacgcgtcctg
gaacgctgtcgcgaactaaatctgacggagcgctgcctggagttgccctcgagatcggcc
accaaggatgagattctgcgcctgcacacagaggagcacttcgagcggctaaaggagacg
tccgggattcgcgatgacgagcgcatggaggagctgagctcccgctacgattcaatttac
attcatccgtccactttcgagctctccctactggccagcggctctaccatcgagttggtg
gaccatctggtcaccggaaaggcgcagaatggcatggccatcatccggccaccgggtcac
catgcgatgaaggccgagtacaacggctattgcttcttcaacaacgtggcactggccacc
cggcacgccctcgatgtgcacaagctgcagcgcatcctgatcatcgactacgatgtgcat
catggacagggaacccagcggttcttctacaacgatcccagggtggtttacttctccatc
catcgcttcgagcacggcagcttctggccgcatctgcacgagtcggactaccacgccatt
ggatcggaagcgggcacgggatacaacttcaatgtgccgttgaatgcgacgggtatgacc
aatggcgattacctggccattttccagcagttgctgctgccggtggccctggaattccag
ccggagctgatcatcgtttcggctggctatgatgcggcgctgggctgtccggagggtgag
atggaggtgacgccggcctgctatccgcacctgctgaatccgctgctgcgactggccgat
gcccgggtggccgtcgttctggagggcggctactgcctggactcactggccgagggtgcg
gccctaaccctgcgctccctgctcggtgatccctgtccgccgctggtggagacagtgcca
ctgccgcgtgcggaactcgcccaggccctgctcagctgcattgccgtgcaccgaccccac
tggcggtgtctgcagctccagcagacctatgattgcgccgaattgcaggatcgggataag
gacgaggatctgcacacggtgctgcgccactggatgggcggaccaccgcctgttgatcgt
taccctacgcgcgatacggccattccgctgccaccggaaaaggtggtcagcaatgcggct
cgtctgcaggtgctgcgcgcggagaccaagctatcggtgccgtcggtgaaggtgtgctat
gcctacgatgcccaaatgcttctgcactgcaatctcaacgatacggggcatccggagcag
ccgtcgcgcatccagcacatccacaagatgcacgacgactacggtctgctgacgcagatg
aagcaactgtccgccagggcggccaccacggacgaggtgtgcctggcccacactcgcgcc
catgtgaatacagtgcgtcgattgcttggccgcgagccgaaggaactgcatgacgctgct
ggggtctacaactcggtgtacctgcatccgcgcaccttcgactgcgccgtcctggccgcc
gggtcagtgctgcaggcggtggacagtgtgctgcgtggcgagtcccgcagcggcatctgc
aacgtccgtccgccgggccatcatgccgagcaggatcatccgcacggcttctgcatcttc
aataatgtggccattgcggcgcagtatgccatacgggacttcggtctggagcgtgtgctg
atcgtggactgggacgtccatcacggcaatgggacgcagcacatcttcgagtccaatccc
aaggtgctctacatcagcttgcatcgctacgagcacggctccttcttccccaagggaccc
gatggcaacttcgatgtggtgggcaagggagccggcaggggcttcaatgtgaacataccc
tggaacaagaagggcatgggtgacctggagtacgcactggccttccagcagctggtcatg
cccattgcgtacgagttcaatccgcagctggtgttggtatccgccggattcgatgctgcc
atcggcgatcccttgggcggatgcaaggtgacgcccgagggttacggcatgctcacccac
tggctgtcggctttggccagcggtcggataatcgtttgcctggaaggtggctacaatgtg
aactccatttcgtacgcgatgaccatgtgcaccaagacgctgctgggtgatcccgtgccg
acgccccagctgggagccacggcgctgcagaagccaccaacggtggccttccagagctgt
gtggaatcgctgcagctgtgcctgcaggtgcagcgcacccactggcgctcgctggagttc
gtcggacggcggctgccgcgcgatcccgtcgtgggcgagaacaacaacgaggattttctt
accgcctccttgcgacacttgaatatctcaaatgacgatgctacggttgcggcaagcgga
cccgccgtcgatcgtcccgactgcggcgatgagcggcccagcgggagcaagcccaaagtc
aaggtaaaaacgctcagcgactacttggcggataacaaggaggccctcgaacagagtgag
atgttcgccgtgtatccgctcaagacgtgtccgcacttgaggctcctgcgtccggaggag
gcgccccgatcactagacagcagagcggagtgcagcgtttgcggatcgacgggggagaac
tgggtgtgcctgagctgcaggcatgtagcctgcggtcgctatgtaaacgcccacatggag
cagcattcggtggaggagcagcatccgctggcgatgagcacggcggacctgtctgtgtgg
tgctacgcgtgctccgcgtacgtggaccatccccgcctgtatgcctacctcaatccgctg
cacgtggacaagttccaggaaccgatggcctggacacatggctgtgcgtgtcgcgaggat
ggatgctatgctacggggcccgatggtcgagatgaggatgacgagaataatgatgatgac
aatgtcgccggtagcagcatctgcctgcgactggagcgcaacaactgacccttagccatc
cgcgtgctggacgccctcacggactacgtgtgcgcgctctgcccgccactcagacaccta
atccagttcctggccgagcacctctggccgctgctggagcgcatttacctaaacctattg
cactacttcctggcccactga

DBGET integrated database retrieval system