KEGG   Drosophila simulans: Dsimw501_GD18634Help
Entry
Dsimw501_GD18634  CDS       T01065                                 

Gene name
Dsim_GD18634
Definition
(RefSeq) uncharacterized protein, isoform B
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
dsi  Drosophila simulans
Pathway
dsi00270  Cysteine and methionine metabolism
dsi00330  Arginine and proline metabolism
dsi00410  beta-Alanine metabolism
dsi00480  Glutathione metabolism
dsi01100  Metabolic pathways
Module
dsi_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Dsimw501_GD18634 (Dsim_GD18634)
   00330 Arginine and proline metabolism
    Dsimw501_GD18634 (Dsim_GD18634)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Dsimw501_GD18634 (Dsim_GD18634)
   00480 Glutathione metabolism
    Dsimw501_GD18634 (Dsim_GD18634)
Enzymes [BR:dsi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     Dsimw501_GD18634 (Dsim_GD18634)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Spermine_synth Methyltransf_31 DUF43 Methyltransf_25 MTS Shikimate_DH
Motif
Other DBs
NCBI-GeneID: 6728754
NCBI-ProteinID: XP_016035428
FlyBase: FBgn0190155
LinkDB All DBs
Position
3R
AA seq 217 aa AA seqDB search
MISFLPLCAHPNPKKVLIVGGGDGGVAREVVKHPLVEEVHQVEIDDRVVELSKQYLPAMA
CGFANEKLKLTIGDGFDYMKKHKNEFDVIITDSSDPIGPAVSLFQESYYELMKHALKEDG
IVCSQGGSFWLDLDYIKKTMSGCKEHFAKVAYAVTSVPSYPCGHIGFVMGSLNKNQDFAT
PKLGKSEIDAIDLRYYSSEVHSAAFALPRWVQKHFYE
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgatatccttcctgccgctctgcgcccatcccaatcccaagaaagtccttatcgtgggc
ggtggcgatggcggcgttgctcgcgaagtggtaaagcacccactggtcgaggaagtgcat
caggtggaaatcgacgaccgtgtcgtcgagctgtccaagcaatatctcccggcgatggcc
tgtggcttcgccaacgagaagttgaagctgaccattggcgatggtttcgactatatgaag
aaacacaagaacgaatttgatgtcatcatcaccgacagctcggatcccattggtccggca
gtgagcctgttccaggagagctactacgagctaatgaaacacgcgctgaaggaagacgga
atcgtgtgctcccagggcggtagcttctggctggacctggactacatcaagaagaccatg
tccggctgcaaggagcactttgctaaggtggcctatgccgttacctccgttccgtcctat
ccctgcggccacattggcttcgtcatgggctccctgaacaaaaaccaggatttcgctact
cccaagctcggaaagtccgaaatcgatgccatagacctaaggtactactcctccgaggtt
cactccgccgcctttgccttgcctcgatgggtgcagaagcacttttacgaatga

DBGET integrated database retrieval system