KEGG   Drosophila simulans: Dsimw501_GD19803
Entry
Dsimw501_GD19803  CDS       T01065                                 

Gene name
Dsim_GD19803
Definition
(RefSeq) uncharacterized protein
Organism
dsi  Drosophila simulans
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Shikimate_DH Cullin
Other DBs
NCBI-GeneID: 6726850
NCBI-ProteinID: XP_002102252
FlyBase: FBgn0191292
UniProt: B4QWZ3
LinkDB
Position
3R
AA seq 257 aa
MPSFKDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNVEKLKETAEQIVKAGGAPALQ
VAADMNSESDVQGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLY
QLTHLVTPELIKTKGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRV
NSVNPGVIITELQRRGGLDEEAYAKFHEHAKVTHALGRPGEVKEVAAAIAFLASDEASFS
TGISLPVDGGRHAMCPR
NT seq 774 nt   +upstreamnt  +downstreamnt
atgcccagtttcaaggataaagttatcatcgtgaccggtgccagttcgggaattggagca
ggtacttcggtgctcttggccaaactgggaggcctgctcaccatcgtcggcaggaatgtg
gagaagctcaaagagaccgcagagcagatagtgaaggctggaggagcgccagcacttcag
gtggcggcggacatgaacagcgagtcggacgtccagggcatcgtatccgccacgttggcc
aagcacggtcgcatcgacgtgctggtgaacaacgccggaatcttggagctgggcagcatc
gagaacaccagtctcgagcagttcgaccgcgttatgaacaccaacgtgcggtcgctctac
cagctgacccacctggtcactccggagctaatcaaaaccaagggcaatattgtgaacgtg
tccagtgtgaacggcatccgttcctttcccggagtcttggcatacaatgtttccaaagct
gccgtggaccagttcaccaggtgcgtggccctggagctggctcccaagggtgtgcgtgtg
aactccgtaaatcccggcgtgatcatcaccgaactccagcgtcgaggtggattggacgag
gaagcatacgccaagttccacgagcacgccaaggtcacccatgccctgggtcggcccggc
gaagtcaaggaggtggctgcggccattgcattcctggccagcgacgaggccagtttcagc
accggtatcagcctgcccgtggacggaggtcgccatgccatgtgccccagatga

DBGET integrated database retrieval system